(data stored in ACNUC7421 zone)

EMBL: CP002157.PE179

CP002157.PE179       Location/Qualifiers
FT   CDS_pept        complement(204694..205776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17026"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00808"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN8"
FT                   /protein_id="EAR00808.1"
FT                   /translation="MRVITIYLVVFFSTLAVQNVISQEEDYQQKVEFLLRQKEQISLQE
FT                   KEALKFEVEQINKRYEKNQISYEESKVLKETAAKKRALNIENRVAIVENEILLLERNHG
FT                   EVLDVETIDSTGISSIEINFDFKRADGSSLLWEKRRRIKRELKYDRRTYSDFVMAIGLN
FT                   NALIDGRSINDSPYKIGGSRFFEMGWSWRTRVFENTNFLRLNYGFSFQFNGLKPKNNQY
FT                   FVAENGQVELQDFEFDLKKSKIRMDNLVFPVHLEFGPSKLHKTDKTMRYSLRNQFRLGI
FT                   GAYGGFNMGTRQKLKYNRNGENVKDKLKRGYNTNDLVYGLSAYVGFDGVLLYAKYDLNP
FT                   IFKDALIEQNNISLGLRFDL"
     atgagagtta ttaccattta tttagtagtg tttttttcca ctttggcggt ccaaaacgta        60
     attagccagg aagaggatta tcaacaaaaa gtagaatttc tgctgaggca aaaagaacaa       120
     ataagtcttc aagagaaaga ggcattgaag tttgaagtag agcagatcaa caaacgatat       180
     gagaaaaatc aaattagcta tgaagagtcc aaggtattaa aagaaaccgc agcaaaaaag       240
     cgcgcactca acattgaaaa ccgagttgct atagtagaaa atgaaattct tttattggag       300
     cgtaaccacg gagaagtttt ggatgttgaa actattgata gcactgggat atcttctata       360
     gaaattaatt ttgattttaa aagagcagac ggttcatcgt tactttggga aaaaagaaga       420
     agaataaaaa gagaattaaa atatgaccga aggacgtatt ctgattttgt aatggccatt       480
     ggcctgaaca atgcactgat tgatggtcga tcaatcaatg attctcctta taaaattggt       540
     ggtagccgct tttttgaaat gggttggtct tggagaacac gggtttttga aaatacgaat       600
     tttttacgat tgaactatgg gttttctttc cagtttaatg gcctaaagcc caagaacaac       660
     cagtattttg tggccgagaa tggacaagtt gaattgcaag atttcgaatt tgatcttaag       720
     aaatcaaaga ttagaatgga taatttggtt ttccctgttc atttggaatt tggtccctca       780
     aaattgcata agactgacaa gacgatgcga tattcacttc gaaatcaatt tagattggga       840
     attggagcct acggagggtt taatatggga actcgccaga aactgaagta caaccgtaat       900
     ggtgaaaacg tgaaagataa attaaaaaga gggtacaata ccaatgattt agtatatggt       960
     ttaagtgctt atgtgggttt tgatggggtt ttgttatacg cgaagtatga tttgaacccg      1020
     atttttaaag atgcacttat agagcagaac aatatctctt tgggccttcg gtttgattta      1080
     tag                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page