(data stored in ACNUC7421 zone)

EMBL: CP002157.PE180

CP002157.PE180       Location/Qualifiers
FT   CDS_pept        complement(205857..206600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17031"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00809"
FT                   /db_xref="GOA:A4ATN9"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN9"
FT                   /protein_id="EAR00809.1"
FT                   /translation="MEPDKFEKHIKNKLNEREISPSMESWDKISSQLQSPETSKSNRFF
FT                   WYSIAAAFVGVLLISTIFFNRQEAAINTEVQIVETPKESINIPEKQHEVINQKEVEEKV
FT                   INAQRVIVQKKINEPREKIEKAIDNDSQIASNEEVNRDITENEIITNTKEQLLNAKIAE
FT                   VVAQVNLLENSNLPVSSAEVDSLLRKAQQEILTDKIFGKEGKVDAMALLNEVEGELDQS
FT                   FREQIFETLKEGFLKVRTAVADRNN"
     atggaacccg ataaatttga aaaacatatt aagaacaaac tgaacgaaag ggagataagc        60
     ccatcaatgg aatcttggga caagatttcc agtcagttgc aatcaccaga gacctcaaag       120
     tccaataggt tcttttggta tagtattgcg gcagcttttg ttggagtatt gctgatttct       180
     acaatatttt ttaataggca ggaggcagct attaatacgg aggttcaaat agtagaaacg       240
     cctaaagaaa gtattaacat acctgaaaag cagcatgagg taatcaacca aaaagaagta       300
     gaagaaaaag ttatcaatgc acaaagagtt attgttcaaa aaaaaataaa tgaaccaagg       360
     gaaaaaatag agaaggcgat agacaatgat tcgcaaatag cctctaacga ggaggttaat       420
     agagatatta ctgaaaatga aattataacc aacacaaaag agcagttgtt aaatgcaaaa       480
     attgcagagg tcgttgctca agtcaatttg ttggaaaata gcaatttgcc ggtttcaagt       540
     gctgaagtag attcattgct gagaaaggca caacaagaga tcttgaccga taaaattttt       600
     ggtaaagagg gcaaagtaga tgctatggca ctattgaatg aagtagaagg ggagttggat       660
     cagtcattta gagagcaaat ttttgaaacc ttaaaggaag gtttcctcaa agtaagaacg       720
     gcggttgctg accgcaataa ttag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page