(data stored in ACNUC7421 zone)

EMBL: CP002157.PE197

CP002157.PE197       Location/Qualifiers
FT   CDS_pept        complement(221346..222095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17116"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00826"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATQ6"
FT                   /protein_id="EAR00826.1"
FT                   /translation="MKKILNILLFMILISCNNENAPDCFQDAGELVRVEVDMDTFAKIT
FT                   VFENVSLILEQGDVQKVEIETGEFLLNEVTAYVEGDRLILQNENGCNFFRDYGLTKVYV
FT                   TSPNITEIRSSTGLPIKSNGVLGYSSIRLYSESFVNPDAETTDGEFDLELNSKNVGVVA
FT                   NGIAYFKLRGNTEHLSVTVAAGDSRIEAEDLVSETISLNHRGTNDIQVNPQQSITGVIR
FT                   GTGDVISFNQPATIEVEELYTGKLIFK"
     atgaaaaaga tactgaacat attacttttt atgattttga tctcttgtaa taatgagaat        60
     gcaccggact gttttcaaga tgccggagaa cttgttaggg tagaagttga catggacact       120
     ttcgcaaaaa taacggtgtt tgaaaatgtt agcttaatac ttgagcaagg tgatgtgcaa       180
     aaggtggaga ttgaaacggg tgaatttctt ctaaacgaag ttactgcata cgttgaaggt       240
     gatagattga ttttgcaaaa tgaaaacggt tgtaatttct tcagggatta tggtcttacc       300
     aaagtatatg ttacttctcc aaatattaca gaaatacgaa gtagcactgg gttgccaatt       360
     aaaagcaatg gagttctagg ttattcttct ataaggttgt attcggaaag ttttgtaaat       420
     ccggatgcgg aaaccacaga tggggagttc gatttggaat tgaattcgaa aaacgtaggg       480
     gtggttgcaa acggaatagc atatttcaaa ttaaggggaa atacggagca cttaagtgtg       540
     acagtggctg ctggtgattc acgaattgaa gctgaagatt tggtttctga aactattagc       600
     cttaatcata gaggaaccaa tgatatccaa gttaacccac aacaatcaat aactggagtt       660
     atccgaggta ctggagatgt aataagtttt aatcaaccag caacaattga ggttgaggaa       720
     ttgtacacgg gcaaactaat tttcaagtag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page