(data stored in ACNUC7421 zone)

EMBL: CP002157.PE201

CP002157.PE201       Location/Qualifiers
FT   CDS_pept        complement(226939..227421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17136"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00830"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR0"
FT                   /protein_id="EAR00830.1"
FT                   /translation="MRGFGVFIVVMTTFISCNLSNKKQIENLKETGNNLEGTWKLVYGE
FT                   IRENDSVVVRDLSKADFIKIINKSHFAFFNQKPKTSEGFYAGAGTYELKGEDYIETLEF
FT                   IGADNLRNHKFPFKITIKGDSLIQTGLEEIKEAGLKRYIVEKYIRIGYENQINRLN"
     atgagaggtt ttggtgtttt tattgttgtc atgacaactt ttatatcttg taatttgtcc        60
     aataaaaaac aaattgaaaa tctcaaagag acaggtaata acttagaagg tacttggaaa       120
     ttagtgtatg gtgaaattcg tgagaacgat tcagtggtcg taagggattt atcgaaagct       180
     gattttataa aaatcatcaa caaatcccat tttgcctttt tcaatcaaaa accaaaaact       240
     agtgaagggt tttatgcagg tgcaggaacg tatgagctga aaggtgaaga ctatatagaa       300
     acattggaat ttattggagc cgataattta agaaaccaca agtttccttt taaaattaca       360
     ataaaaggag attctctaat tcaaactggt ttagaagaaa taaaggaagc tggtttgaaa       420
     agatatattg ttgaaaagta tatcaggatt ggttatgaaa accaaattaa tcgtttgaat       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page