(data stored in ACNUC7421 zone)

EMBL: CP002157.PE208

CP002157.PE208       Location/Qualifiers
FT   CDS_pept        complement(233612..234511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17171"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17171"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00837"
FT                   /db_xref="GOA:A4ATR7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR7"
FT                   /protein_id="EAR00837.1"
FT                   /translation="MKDTSNINALENEAIYIMREVAAQFEKPVLLFSGGKDSITLVRLA
FT                   QKAFYPAKIPFPLMHIDTGHNFPETIEFRDRLVEELGLELIVRNVQDSIDQGKVKEESG
FT                   RYSSRNSLQTTTLLDAIEEFKFDACIGGARRDEEKARAKERVFSVRDDFGQWDEKNQRP
FT                   ELFDMLNGQIELGQNVRVFPISNWTELDVWSYIEKEEIEIPSIYFAHKRKIFLRDGLIW
FT                   SHSDYVFQEDHEEVLEKMVRFRTVGDMSCTAAVFSEAADIASVVQEIRESTISERGARI
FT                   DDKRSEAAMEKRKQQGYF"
     atgaaagata cttcaaatat taacgcgcta gaaaacgagg cgatttatat aatgagagag        60
     gtagccgccc aatttgaaaa gccggtttta ttgttttcag gaggaaaaga ctcaataact       120
     ttggtaagat tggctcaaaa agctttttat ccagcaaaga ttccctttcc attaatgcac       180
     attgatactg gacataactt tccagagaca atcgaattta gggatagatt ggttgaagaa       240
     ttagggttgg aattaattgt gaggaatgtt caggattcta tagaccaagg aaaggttaaa       300
     gaagaatctg ggcgatattc gagcagaaat tctttacaaa caaccaccct tttagatgct       360
     attgaagagt tcaagtttga tgcttgcatt ggtggagcac ggcgtgatga agaaaaggcc       420
     agagccaagg aacgcgtgtt ttcagtgcgg gatgattttg gacaatggga tgagaagaat       480
     caaaggccgg agcttttcga tatgttgaac ggacaaatag aattgggtca aaatgtaagg       540
     gtttttccaa tttccaattg gacagaatta gacgtttggt cttacataga aaaagaagaa       600
     attgaaatac cctctatata ctttgcccat aaaagaaaga tattcctgcg tgacggattg       660
     atttggtcgc attctgatta tgtattccaa gaggatcatg aagaagtatt ggaaaaaatg       720
     gttcgtttta gaactgtagg agatatgagc tgtaccgcgg cagtattttc tgaggctgcc       780
     gatattgcca gtgtggtcca agaaataagg gaatctacca tttcagaaag aggtgcaagg       840
     atagatgata agcgctctga ggcagccatg gaaaaaagaa agcaacaagg atatttttaa       900
//

If you have problems or comments...

PBIL Back to PBIL home page