(data stored in ACNUC7421 zone)

EMBL: CP002157.PE210

CP002157.PE210       Location/Qualifiers
FT   CDS_pept        complement(235194..235454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17181"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00839"
FT                   /db_xref="GOA:A4ATR9"
FT                   /db_xref="InterPro:IPR018638"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR9"
FT                   /protein_id="EAR00839.1"
FT                   /translation="MIADQLILNKKEKTDFQKDRKSEKPIRSIAKAFSWRVVGTLDTLL
FT                   ISYILTGKIALAASIASIDFLTKMVLYFFHERLWNLVNWGK"
     atgattgcag accaattgat tttaaataaa aaggagaaga ccgattttca aaaggacagg        60
     aaatctgaaa aacccattcg tagtattgcc aaagcattca gttggagagt tgtcggcact       120
     ttggataccc ttcttatttc gtacatactt acgggaaaga ttgctttggc agcttctatt       180
     gcatcaatag attttttgac taaaatggtg ctgtattttt ttcacgaacg cttatggaac       240
     ctggttaact ggggcaaata g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page