(data stored in ACNUC7421 zone)

EMBL: CP002157.PE216

CP002157.PE216       Location/Qualifiers
FT   CDS_pept        complement(243845..246523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17211"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00845"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR041700"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATS5"
FT                   /protein_id="EAR00845.1"
FT                   /translation="MKRILFCIAFFGVMVSCLAQEVLLTGIVSDSTGTNIEMANVIAIN
FT                   DETKGLESYGITNHSGRYKLNLKMNVAYTVKISYIGFATEVFAITPVAKEITKDFTLNQ
FT                   QVNMLDDVEVTYEMPVSVKGDTIVYDTDAFVTGTEKKLKDVLENLPGIEVNDNGQIEVE
FT                   GKTVQKVMVEGKDFFDGDSKLAVENIPADALSKVEVLKNYNEISQMRGLTNDDDNVALN
FT                   IKLKEGKKNFWFGEITAGYGPEARYLAHPKLFYYSPKGSINIITDMNNVGEVPFTRRDY
FT                   RNFTGGFRNLNSRGGSSIGTGSDALGLSTMQNNRAKDLETKFAAVNVSYSPNKAWDLSG
FT                   FGIYSYTGTLMETQKSTTFISSNEIEEASTKTDQTVHLGLAKLSTRFKPNDDFQMDYDL
FT                   FLKQSDDFETIDVLSVSDIVDEIVEEKKQKPTSINQNVNLYYTMNDKNIFAVEAQYLYQ
FT                   AEDPFYEALRREFAFSDIFPVVTDQEMYDLNQAKKTFTNKVDAKIDYYHILGSKSNLNL
FT                   TLGTTQSHQNFNSSIYQILDNASALTLTGNDFENDITYSVSDLYMGFHYKFITGIFTFN
FT                   PGATLHTYTAKNLQSDTEVTDKLTSFLPDMYINMQLKKSENLRFNYQMTRAFTDVNKFA
FT                   LAYVLNSYNSIYRGNRDLESALNHNLSLNFFSFNMFNFTNIFGNIVYTKKIDAFKNSSE
FT                   IVGINRVGTTINSNFKDESLSAMGRYERTFGKIKGSFRGNVAWSTTNNLIGGEQQTSDS
FT                   FTQSYTTSLSTNFSNAPNLELGYRYMVNNYKNADLETTFYTKRPFVKFDTPLFKNFIFN
FT                   LDYDYYQYTDKENTIKNTYGFLESNLSYQKADSKWEFGLKGTNLLDTDSLNSDSTNELF
FT                   YATQSYFVQPRYVLFTVKYNL"
     atgaaaagga tattgttttg tattgcattt tttggtgtta tggtttcctg tcttgcccag        60
     gaagttttac ttactgggat tgtaagtgat agtacaggta caaacattga aatggccaat       120
     gttattgcca ttaatgatga gaccaaggga ttagagtcat atgggattac aaatcattca       180
     gggcgttaca agcttaacct gaagatgaat gtggcatata cagtaaaaat aagttacata       240
     ggttttgcta ccgaagtttt tgcaataact cccgtcgcta aagagattac caaggatttt       300
     actttgaacc aacaagtgaa tatgttggat gatgttgaag tcacttatga aatgccggta       360
     tcagtaaagg gtgatactat tgtttatgac acggatgctt ttgttaccgg tacagaaaaa       420
     aagttaaaag atgtattaga gaaccttcct ggaatagagg tcaatgataa tggacaaatt       480
     gaagttgagg ggaaaacggt gcaaaaagtg atggtagagg gcaaagattt ttttgatggc       540
     gattctaaat tggcagtcga gaatattcca gctgatgcgc tcagtaaggt cgaagtttta       600
     aaaaactata atgaaatttc gcaaatgcga ggtttaacca atgatgatga taatgtagca       660
     ttgaacatta aattaaagga agggaaaaag aatttttggt ttggtgaaat tacggcagga       720
     tatggtccag aagcccgata tctggcacac cctaaactat tttattactc gcctaagggc       780
     agtatcaata tcataacaga tatgaataat gtgggcgaag tgccttttac tcgacgcgat       840
     tacagaaatt ttactggcgg ctttagaaat ttgaactctc gtgggggaag tagtattggt       900
     acaggttcag atgcattggg gctttcaaca atgcagaata atagggccaa agaccttgaa       960
     actaaatttg ctgcggtaaa tgtgagttat tctccaaata aagcctggga tttaagtggt      1020
     tttggtattt attcctatac tgggacatta atggaaaccc aaaaaagtac aaccttcatt      1080
     tccagtaatg aaatagaaga ggcttctact aaaactgatc aaaccgttca tttagggttg      1140
     gctaagttaa gtacaagatt taaacccaat gatgattttc aaatggatta cgatttgttt      1200
     ttgaaacaat cagatgattt tgaaacaata gatgtgcttt cagtatctga tattgtagat      1260
     gaaatagttg aagagaaaaa gcaaaaacct acatcaataa atcaaaatgt gaatctgtac      1320
     tatacaatga acgacaagaa tatttttgct gtcgaagccc agtatttgta ccaagccgaa      1380
     gacccattct atgaagctct aagaagggag tttgcttttt ctgatatttt tcctgtggtt      1440
     accgaccaag aaatgtacga tttaaatcaa gcaaaaaaga cattcacgaa taaggtggat      1500
     gcaaaaattg attattacca tattttagga agtaaaagca atttgaacct tactttgggt      1560
     accactcaaa gccatcagaa tttcaattcc tccatttatc aaatattgga taatgccagt      1620
     gcattgacct taacgggtaa tgactttgaa aacgatatta catactccgt ttcagatttg      1680
     tacatgggtt ttcattataa atttattaca gggattttca ctttcaatcc tggggccaca      1740
     ttgcatacat acacagcaaa aaatcttcag tcagatacag aggttaccga taagctgact      1800
     tcttttttgc ccgatatgta tataaatatg caactcaaaa aatctgagaa tttaaggttc      1860
     aattaccaga tgacccgtgc ttttaccgat gtgaataaat ttgccctggc atatgtactt      1920
     aattcctata attcgatcta taggggcaat cgtgatttgg aaagtgcttt aaaccataat      1980
     ctgtcgctga atttctttag tttcaatatg ttcaatttca cgaatatttt tgggaatatc      2040
     gtttacacta aaaagattga tgcctttaaa aacagttcag aaattgtcgg aatcaataga      2100
     gtcgggacta ccataaattc aaattttaaa gatgaatcat tatcggcaat gggtaggtat      2160
     gaacgtactt ttggaaagat aaaaggttct tttcggggca atgttgcatg gtcaacaaca      2220
     aacaacctta taggagggga gcagcaaact tcagattcgt ttacccaaag ttatactacc      2280
     tcattatcga ctaatttcag taatgcccca aatttggaat taggttacag atatatggtc      2340
     aataattata aaaatgctga cttagaaaca accttttaca ccaaaaggcc ctttgtaaag      2400
     tttgacaccc ccctttttaa gaattttatt ttcaatcttg attacgatta ttatcagtat      2460
     acagataaag aaaatacaat taaaaacacc tacggctttt tagagtccaa tttaagttac      2520
     caaaaagcag atagtaaatg ggaatttggg ttaaagggta cgaacttact tgataccgat      2580
     tctttgaata gtgatagtac gaatgaatta ttctacgcaa cacaatccta ttttgtacag      2640
     ccgcgatatg tgctttttac tgtgaagtat aatctttag                             2679
//

If you have problems or comments...

PBIL Back to PBIL home page