(data stored in ACNUC7421 zone)

EMBL: CP002157.PE217

CP002157.PE217       Location/Qualifiers
FT   CDS_pept        complement(246575..247531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17216"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00846"
FT                   /db_xref="InterPro:IPR005901"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATS6"
FT                   /protein_id="EAR00846.1"
FT                   /translation="MKILSIKSDEKIFNFGLNLFTKESSNNQIKITDMKLVLISLLFLL
FT                   TLQSVISQDFQGKAVYESKTQVNMDFGGRQIPEDRKKEIMERIKSASERSFTLIFNTAE
FT                   SIYKEEEKLEQPNTYNRRGMMFRMMSGGNGDYYKNIQEQKYLSKNELLGKIFLIEDSLP
FT                   KLDWKMGSETKQIGNYTAFKATATKMIQRRNPRAFRPPGPGPEGNRKMNDDKEEKEEEV
FT                   IEKEVQIVAWYTPEVPINHGPDEYWGLPGLILEVRDDITTIICSKIILNPKEKVDIKAP
FT                   TKGKKVNQQEYNDISKKKMQEMRENFRNRRPPGDRRF"
     gtgaaaatcc taagcataaa atccgatgaa aaaatattta attttggatt aaacctattc        60
     acgaaagaat cgtctaataa tcaaatcaaa attactgaca tgaaattagt attgataagt       120
     ctcttgtttt tgcttaccct tcaaagcgta atttcccaag atttccaagg aaaggcggtt       180
     tacgaaagta aaacacaggt gaatatggat tttggcggaa ggcaaattcc agaagaccgt       240
     aaaaaggaaa ttatggaacg tattaaaagc gccagtgaaa ggtcttttac actcattttc       300
     aatacggccg aatcaattta taaagaagag gaaaagctgg agcaacccaa tacttataat       360
     agacgtggaa tgatgttccg tatgatgagt ggtggtaatg gggattatta taagaacatt       420
     caagagcaaa agtatttatc gaaaaatgaa cttttaggaa agatattttt gatagaggac       480
     agccttccaa aactagattg gaaaatgggt agtgaaacga aacaaattgg aaattatacc       540
     gctttcaaag ctaccgccac aaaaatgata caacgaagaa acccgagggc ttttagacca       600
     cctggtccgg ggccagaagg aaataggaaa atgaatgatg ataaagagga aaaggaggaa       660
     gaagttattg agaaagaagt tcagattgtt gcatggtata ctccagaagt gccaataaat       720
     catggtcctg atgaatactg gggtcttccg gggcttattc ttgaagttag agatgatatt       780
     acaacaatca tctgttccaa gattatattg aacccaaaag aaaaggtaga tataaaagct       840
     cccacaaaag gtaaaaaagt gaaccaacaa gagtataatg acatctcaaa aaagaaaatg       900
     caggaaatga gggagaattt tagaaataga aggccgccag gagatcgtag attctaa          957
//

If you have problems or comments...

PBIL Back to PBIL home page