(data stored in ACNUC7421 zone)

EMBL: CP002157.PE22

CP002157.PE22        Location/Qualifiers
FT   CDS_pept        complement(37120..38010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16241"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00651"
FT                   /db_xref="GOA:A4AT81"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT81"
FT                   /protein_id="EAR00651.1"
FT                   /translation="MKKFKSHFKFSKQERSGIFFLLLIIVFLQVCFFIFKYTFKNEESS
FT                   LVLDEETQAKIDSLKQELAIRDSITIYPFNPNFISDYKGYTLGMSVKEIDRLHAFRSDG
FT                   KFINSALEFQMVTKISDSLLKLISPNFKFPSWVSNKNKDSETGRSLFQNKSQFETTIKN
FT                   FEIKEINSVTAEELQTVSGIGDKLSNRIIKFRDRLGGFMVNEQLYDVYGLEPVVVKRAL
FT                   ERFKVLSEPSISKIDINTASAQEISKLIYLRYELASKIVEYRQVNGVFASFEELNNIEG
FT                   FPTDKINRIQLYLSL"
     atgaagaaat tcaaatccca ctttaagttt tctaaacagg aacgaagtgg gattttcttt        60
     ttgttattga ttatagtttt tttgcaggtt tgcttcttca tattcaagta tactttcaaa       120
     aacgaagaat caagtcttgt tttggatgag gagactcagg caaaaataga ttctttgaaa       180
     caggagctgg ccatcaggga ttcaataacc atttaccctt ttaatcccaa ttttatttca       240
     gattataaag gatatacatt gggcatgtca gtgaaagaga ttgatagact tcatgccttt       300
     aggtctgatg gaaagtttat aaacagtgcg ttggaattcc agatggttac caaaatatct       360
     gattctttac tgaagttgat atctcccaac tttaagtttc caagttgggt ttcaaataag       420
     aataaagatt ctgaaacagg taggagtctt tttcaaaata agagccaatt cgaaactacc       480
     ataaagaact ttgaaatcaa ggaaataaac agcgttaccg ccgaagagct ccaaaccgta       540
     agtggtattg gagataaact ttccaacagg ataataaaat tcagggacag gcttgggggt       600
     tttatggtca acgaacagct ttatgatgta tacggacttg agcctgtagt ggtaaagaga       660
     gcgcttgaaa gattcaaggt tttaagcgag ccaagcattt caaaaatcga tattaacaca       720
     gcttctgctc aagagatttc aaaattaatt tacttaagat atgaacttgc aagcaaaatt       780
     gtggaatata ggcaagtgaa cggggttttc gcatccttcg aagaattaaa taatattgaa       840
     ggtttcccaa ctgataagat caatagaatt caattatatt tgtccctcta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page