(data stored in ACNUC7421 zone)

EMBL: CP002157.PE223

CP002157.PE223       Location/Qualifiers
FT   CDS_pept        complement(253098..255593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17246"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00852"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT2"
FT                   /protein_id="EAR00852.1"
FT                   /translation="MKNFLFLFFFLFSLIIWSQTKVGGTVIDESGEPVAFANVIFKNST
FT                   EGTTTDDNGNFYMESDASYDILEISFIGYETQDIELTSRVTYKMKITMLEGSQQLKEVI
FT                   IYAGKQSKKNNPAVDLLRKIWAKKRVNGLRMFKQYQYDKYEKVEFDLNTIDSALMKKKI
FT                   FKGMEFVFQDLDTSRITGKTYLPIFLNETFAKVYGDNITKVEKEDVLGNKNSGFDNNQA
FT                   IIAFVEDLYQDYDVYDNYLKFFDKSFTSPLSRTGIDTYNYVLRDSAFIDNKWCYNITYY
FT                   PRRKNELTFKGDFWVNDSTYAIKNINLEVTKSANINWVKEIYIEQDFDVVSDSVFLLKR
FT                   DYMLTDFSFNKKEKSKGVYGKRTTVYGDYKFDIEKPRDFYKAKSNEFDPLVLNRDDTFW
FT                   DNSRLESLNKDEQGIYQLLDTLKTVPKFKTFYNIASILGSGYIEIDKWNVDIGDVYSVF
FT                   GYNDAEGIRLRGGARTYFGQNDPWRLEGYMAYGFMDKKAKHGFSAKFLLDKKSRLMISG
FT                   GNRRDVEQLGLSLTSTNDVMGRSIASSSVLTVGSNDRLTNINLSTVSLEIEPVTNFRVR
FT                   VGSSFRTLSSALPDAFNLDYVDPDSPSGISSEVKQFDINTLLVYTPGKRTIGYGVERYD
FT                   INDTYSTLLLNYTRGFEGFLESDFDYSKLQFSYSQPWQVGGFGRLNSTIEVGKTFGEVP
FT                   LSLLNVVPGNQTLFTIYKTFPNLDFYEFVTDTYASVHLEHNFNGRLFSRIPIIRKWNLR
FT                   EFVGLRGVWGDLSQENIALSSPTNIPLQAPTDQIYWEYSVGVGNILKFFRIDFNFRGNY
FT                   LDSPNARPFSVTGEFGFHF"
     atgaagaatt ttctattcct tttctttttt cttttttctt tgattatatg gtcgcagacc        60
     aaggttggtg gtactgtgat tgatgagtcc ggggagcctg ttgcgtttgc caatgtaatt       120
     ttcaaaaatt ccactgaagg gacgactaca gatgataatg gtaattttta tatggaatcg       180
     gatgcttcgt acgatattct cgaaatctct tttattggtt acgaaaccca agatatcgag       240
     cttacgtcaa gggttaccta taaaatgaaa attaccatgc tagaaggtag ccagcaatta       300
     aaagaggtta taatatatgc gggaaaacaa tccaaaaaga ataatcctgc ggtagattta       360
     ctacgtaaaa tttgggcaaa gaaaagggtt aatggattgc gcatgttcaa acaataccaa       420
     tatgataagt atgaaaaagt agagtttgat ttaaatacca tagatagtgc actaatgaag       480
     aagaagatct tcaaggggat ggaatttgtt tttcaagatt tggatacttc tcgaattacc       540
     ggtaaaacat atctccctat ctttttaaac gaaacctttg caaaagttta tggtgacaat       600
     ataacaaagg ttgagaaaga agatgtcctt ggtaataaga attcaggctt tgataataat       660
     caagcaataa ttgccttcgt tgaagacctg taccaggact atgatgttta tgataattat       720
     ttaaaatttt ttgacaaaag ctttacaagt cctttatcta gaaccggtat agacacttat       780
     aattacgtgt tgagagatag cgcttttatt gataataaat ggtgttataa cattacctat       840
     tacccgaggc gaaaaaatga acttacgttt aaaggtgatt tttgggtaaa cgattcaacc       900
     tatgctataa aaaacataaa ccttgaggtg accaaaagtg ccaatataaa ctgggtcaaa       960
     gagatttaca ttgaacagga ttttgatgtg gtaagcgact ctgtttttct tttgaaaaga      1020
     gattatatgc taaccgattt cagttttaac aaaaaagaaa aatcaaaagg ggtttatggt      1080
     aagcgtacca ctgtttatgg tgactataag tttgatattg aaaagcccag ggatttttat      1140
     aaagccaaaa gcaacgaatt tgaccctttg gtattaaata gggatgacac tttttgggac      1200
     aacagtagat tggaatcctt gaacaaggat gaacaaggaa tctatcagtt gttggataca      1260
     cttaaaacag tgccaaagtt taaaaccttc tataatatag cgagtatttt gggttcaggt      1320
     tatatcgaaa ttgataaatg gaatgttgat ataggcgatg tatacagtgt ttttggttat      1380
     aatgatgccg aaggaatacg attacgagga ggggcaagaa cttattttgg acagaacgat      1440
     ccttggcgat tggaaggtta tatggcgtat ggtttcatgg acaaaaaagc aaagcacggt      1500
     ttttctgcca aatttttatt ggataaaaaa agtagattga tgatttcggg aggtaatcgt      1560
     cgagatgtag aacaactagg cttgagctta acttctacaa atgatgtgat gggccgcagt      1620
     attgcgtctt cctcagtatt aaccgttgga tcaaatgata ggcttaccaa tattaatcta      1680
     agtactgtga gtttagaaat tgaacctgtc accaatttta gggtaagggt tggaagttct      1740
     ttcagaacgt tgagttcggc cttgccagac gcttttaacc tagattatgt tgaccctgat      1800
     tcgccatccg gaatatcttc tgaggtaaag caattcgata ttaacacttt gctggtttat      1860
     actcctggta aacgaactat tgggtatggt gttgagcgtt atgacatcaa tgacacatat      1920
     agcaccttgt tgttgaatta tacgagaggt tttgaaggtt tcttggaaag tgattttgac      1980
     tatagcaaac tacagttctc atacagccaa ccttggcaag tgggtggttt tggtagacta      2040
     aatagtacca tcgaggttgg taaaactttt ggcgaagttc cattgagcct tttgaatgtg      2100
     gttccaggta accaaaccct gttcactata tataagacat ttcctaattt ggatttttat      2160
     gagttcgtca cagatacgta tgcatcagtc catctggagc ataattttaa tggaagatta      2220
     ttttcaagaa taccaataat acgcaaatgg aatttaaggg agttcgttgg gttaagaggt      2280
     gtttggggag atctttcaca ggagaatatt gcactaagta gccctacaaa tattcctctg      2340
     caagcaccta ctgatcagat ttattgggaa tattccgttg gggttggtaa tattctaaaa      2400
     ttctttagga ttgactttaa ttttagggga aattatcttg atagcccaaa tgccagaccg      2460
     tttagcgtta ctggcgaatt tggctttcac ttttaa                                2496
//

If you have problems or comments...

PBIL Back to PBIL home page