(data stored in ACNUC7421 zone)

EMBL: CP002157.PE242

CP002157.PE242       Location/Qualifiers
FT   CDS_pept        272020..272271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17341"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00871"
FT                   /db_xref="GOA:A4ATV1"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV1"
FT                   /protein_id="EAR00871.1"
FT                   /translation="MTKPTLINLKFIEMKKNMGSTDKIVRILIAAIIAVLYFTNIIPGT
FT                   LGIVLLVLAGVFVLTSLISFCPLYAPFGLSTCAMKDKK"
     atgactaaac caactttgat taatttaaaa tttattgaga tgaaaaaaaa tatgggtagt        60
     acggataaga ttgttagaat tttaatagca gcaattattg cagttcttta ttttaccaat       120
     ataattcctg gaactttggg cattgttcta ctggttttag caggagtttt tgtattgacc       180
     agccttataa gcttttgtcc gctttatgct cctttcggat tgagtacttg tgccatgaaa       240
     gacaaaaaat aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page