(data stored in ACNUC7421 zone)

EMBL: CP002157.PE245

CP002157.PE245       Location/Qualifiers
FT   CDS_pept        complement(273689..274753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17356"
FT                   /product="putative peptidase, M28 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17356"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00874"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV4"
FT                   /protein_id="EAR00874.1"
FT                   /translation="MKRIIYFFVLLLVISCGSTKTKQANSDTVYGGPDGVKGRMVEAKE
FT                   ESKTSGISSEEDKTVKLISKGSFSSAERVGEIMNFLASDELNGRDSGTDGIEKAAAYIT
FT                   KAFKENGIKPYFISYRDTLSNIDVHAYNVVGLIEGSDAELKNEYILIGAHYDHIGIRSA
FT                   VNGDEIANGANDNASGTTTVMELARYFGHSKSNKRSLIFALFSAEERGLLGSKHLAEKL
FT                   KTKDLNLYAMLNFEMVGVPLVDKDYEVYATGYELSNLADVFNEYANAKLVGFLPQAKEF
FT                   NLFMRSDNYPFHNELQVPSQTFSTFDFTNFDHYHKVGDEASLMDFEHMASLVNKFIPVI
FT                   ENITNSPVQEIKYN"
     atgaagcgaa taatctactt ttttgttctg ttactagtaa tcagctgtgg ttctactaaa        60
     accaaacaag ccaattccga tactgtttat ggtggccccg atggagttaa aggcaggatg       120
     gttgaggcca aagaagaatc caaaacttca ggaatatcct cagaagagga taaaacagtt       180
     aaattgatct ccaagggctc gttttcaagt gcggaacggg ttggagaaat catgaacttc       240
     ttggcttccg atgagctaaa tgggcgtgat tctggtaccg atggtattga aaaggcagct       300
     gcttacatta caaaagcttt taaagagaat ggtataaagc cttatttcat ttcgtaccgt       360
     gatacgttgt ccaatataga tgtgcatgcc tataacgtag ttggcttaat agaaggttca       420
     gatgctgagt taaaaaatga gtatattttg attggtgcac actatgacca tattggaata       480
     agaagtgctg taaatggtga tgaaattgca aatggggcaa atgataatgc ttcgggaaca       540
     acgacagtaa tggaattggc tcgttatttc gggcattcta aatcaaataa acgaagtttg       600
     atcttcgcat tgttcagtgc agaagaaaga gggcttttgg gctcaaaaca tttggctgaa       660
     aaactaaaaa caaaagattt gaatctatat gccatgctga attttgaaat ggtaggggtg       720
     ccattggttg acaaagatta tgaggtttat gcgacaggat atgaactttc gaatttggcc       780
     gatgttttta atgaatatgc caatgcaaaa ctggtaggct tcttaccaca ggctaaggag       840
     ttcaatctgt tcatgcgttc tgataattat ccgtttcaca atgaacttca agtgccttca       900
     caaacattct caacttttga tttcaccaat tttgaccact atcacaaagt tggagatgaa       960
     gcatcactga tggattttga gcatatggct tccctagtca ataagtttat tcctgttatt      1020
     gaaaatatta ctaattcacc cgtccaagaa attaaataca actaa                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page