(data stored in ACNUC7421 zone)

EMBL: CP002157.PE246

CP002157.PE246       Location/Qualifiers
FT   CDS_pept        complement(274834..276477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17361"
FT                   /product="dihydrolipoyllysine-residue acetyltransferase
FT                   component of pyruvatedehydrogenase complex"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17361"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00875"
FT                   /db_xref="GOA:A4ATV5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV5"
FT                   /protein_id="EAR00875.1"
FT                   /translation="MAEVINMPRLSDTMEEGTVAKWLKQVGDKVEEGDILAEIETDKAT
FT                   MEFESFHEGTLLHIGIAEGDGAPVDSLLAIIGDEGEDISSLLSGSSSEAEEETKEETKE
FT                   ETSGEAEVVSSKPGTEIPEGVEVVKMPRLSDTMEEGTVATWLKKVGDTVEEGDILAEIE
FT                   TDKATMEFESFYSGTLLYIGIQEGESSPVDAVLAVIGPAGTDVDAVLSAAPGTGGESEE
FT                   TTKVEKTEEKKAETPQETMAPSSNDGQRIFASPLAKRIATEKGINLSDVKGTGDHGRIV
FT                   KKDVEGFVPSQKPVQPIAVQDNAGASTSTVVAPLVLPVGEESSEEVKNSQMRKTIAKRL
FT                   SESKFTAPHYYLTIEVDMDNAKASRTQINDLPDTKVSFNDMVVKACAMALKKHPQVNTT
FT                   WNGNTTRYNHHVNIGVAVAVEDGLVVPVVKSTDLLSLTQIGSAVKDLAGRARVKKLTPA
FT                   EMDGSTFTVSNLGMFGILEFTSIINQPNSAILSVGAIIEKPVVKNGQIVVGNTMKLSLA
FT                   CDHRTVDGATGAQFLQTLRAFLENPVTMLA"
     atggcagaag tgataaatat gcctcgtttg agcgatacca tggaagaagg taccgtggcc        60
     aaatggttaa agcaagtagg ggataaggtt gaagaaggag atattcttgc ggaaattgaa       120
     actgataagg ccactatgga atttgaatcc tttcatgagg gtacattgct gcatattggt       180
     attgcagaag gcgatggtgc tccggttgat tcacttttgg caattatcgg tgatgaaggt       240
     gaagatattt caagtttgct aagcggctct tcctcggaag ccgaagaaga gacaaaagaa       300
     gagacaaaag aagaaacgtc aggtgaagcc gaagttgttt cttctaagcc aggtactgaa       360
     attcctgaag gggtggaggt agttaaaatg cctcgtctaa gtgatactat ggaagagggt       420
     accgtagcaa cttggctaaa gaaggtcggt gatactgttg aagaagggga tattctggct       480
     gaaattgaaa ctgataaggc aacaatggaa ttcgaatctt tttattcggg tactttgctg       540
     tatataggta ttcaagaagg ggaatcttct ccagttgatg cggtactcgc cgttattggg       600
     ccagccggaa ccgatgttga tgctgttttg agtgcggccc ccggaacagg tggtgaaagt       660
     gaggaaacaa ccaaggttga gaaaacagag gaaaagaaag ctgaaactcc tcaggaaaca       720
     atggctccta gttctaatga cgggcagcga atttttgcct cacctttagc caaaagaata       780
     gcaacggaaa aaggcatcaa tttaagtgat gtaaaaggaa ctggtgacca cggaagaatc       840
     gtcaaaaaag atgttgaagg ttttgttcca tctcaaaaac cagttcaacc tatagctgtt       900
     caagacaatg caggtgcaag tacttcgacg gttgttgcac cgttggtatt gcctgtagga       960
     gaagagagtt ctgaagaagt gaagaattca caaatgcgta aaactattgc gaaaagatta      1020
     tcagaatcca agtttacagc accacattat tatttgacca ttgaggttga tatggataac      1080
     gcaaaggcat cgagaactca gataaatgat ttgccagaca ccaaagtttc attcaacgat      1140
     atggtggtca aggcttgtgc aatggcattg aaaaagcatc ctcaagtaaa tacaacgtgg      1200
     aatgggaata ctacaaggta taatcatcat gtgaatattg gcgttgccgt tgctgttgaa      1260
     gacggacttg ttgtacctgt tgttaaatca actgatttgt tgagcttaac acaaattggt      1320
     tctgcggtta aagatttggc aggtagggca agggttaaaa agttgactcc tgcagaaatg      1380
     gatggtagta cgtttacagt ttcaaatctg ggaatgttcg gcatattgga gtttacctca      1440
     atcataaatc agcctaattc agcaatttta tctgtaggtg caatcattga aaagccagtt      1500
     gtgaaaaatg gacaaattgt tgttggcaat accatgaaat tgtccttggc atgtgatcac      1560
     cgtactgttg atggtgctac aggagctcaa ttcttacaga ctttaagggc atttttagag      1620
     aaccctgtga ctatgttggc gtaa                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page