(data stored in ACNUC7421 zone)

EMBL: CP002157.PE250

CP002157.PE250       Location/Qualifiers
FT   CDS_pept        complement(278242..279387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17381"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00879"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV9"
FT                   /protein_id="EAR00879.1"
FT                   /translation="MKKLTLLVLLAFAIQLSAQDDRVITTAVPFLTIAADARSAGMGDM
FT                   GVATSTDAFSQQWNPSKFAFAERKMGIGVSYTPYLESIITDISLLNASFYNKIDDQSAF
FT                   ALSLRYFTLGEIELRQFANDPGTLAKPNELALDGSYSLKLSPTFSMAVGGRFIRSNLKL
FT                   PQNGSEDSQAASTFAVDVSGYYRSREIAYDKFDGRWRAGFNLSNLGGKITYDEGGQENF
FT                   LPTNLKFGAGFDFILDQDNVLGITTEFNKLLVPTPQDFDEDGDIDSADNDEYQQIGFFS
FT                   GITKSFNDAPDGFSEELKEFTWALGAEYTYQDAFMIRTGYFNESEEKGSRKFFTMGAGF
FT                   KFKAAQIDLSYLFSTSQVKNPLENTLRFSLTFNLGEEYLND"
     atgaaaaaat taaccttact tgttttattg gcttttgcga tacaattatc ggctcaagat        60
     gatagagtta ttaccactgc ggtacctttt ttgaccattg ctgcagatgc tagatctgct       120
     ggtatgggtg atatgggagt cgcgacttcc acagatgctt tttcgcaaca atggaatccg       180
     tctaaatttg cttttgccga aagaaaaatg ggaattggcg ttagttatac tccgtatctc       240
     gaaagtataa taaccgatat ctctcttcta aacgcgagtt tttataataa aattgatgac       300
     caaagcgcat ttgcattgag tctgagatat tttacgcttg gtgagattga gttacgacaa       360
     ttcgcaaatg atcctggtac attggccaag cccaatgaat tggctttaga tggctcgtat       420
     tctttgaaat taagcccgac attttctatg gctgttggtg gtaggtttat aaggtcaaac       480
     cttaaactgc ctcaaaatgg atcagaggat tctcaagccg caagtacttt cgccgtagat       540
     gtttctggtt attataggtc aagggaaata gcatatgata agtttgatgg tcgttggaga       600
     gcaggtttca atctctctaa tcttgggggc aaaatcactt atgatgaggg cggacaagaa       660
     aactttttgc ctactaattt aaaattcggt gccggttttg attttattct agatcaggat       720
     aatgtactgg gaatcactac agaattcaat aaattactgg tcccaacccc tcaagatttt       780
     gatgaagatg gtgatattga ttctgcggat aatgatgaat accaacaaat tgggtttttt       840
     agtgggatca caaaatcatt caatgatgcg ccagatggtt ttagcgaaga gcttaaagaa       900
     tttacttggg ctcttggtgc tgaatataca taccaagatg cttttatgat tcgtaccggg       960
     tattttaatg aaagtgaaga gaaggggtca agaaaattct ttacaatggg tgctggattt      1020
     aaatttaagg cagcccagat agatttgtcc tatttgtttt caacatccca agttaaaaac      1080
     cctttggaaa atacactacg cttttcactt acctttaatt taggtgagga gtatttaaat      1140
     gattaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page