(data stored in ACNUC7421 zone)

EMBL: CP002157.PE251

CP002157.PE251       Location/Qualifiers
FT   CDS_pept        279737..279841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17386"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00880"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW0"
FT                   /protein_id="EAR00880.1"
FT                   /translation="MTKYYDKIIVLYAERNTKLNQNKNPKLLESGLNN"
     atgacaaaat attatgacaa aatcatcgtt ttatatgccg aaagaaacac caaattaaat        60
     caaaacaaga atcccaaact acttgaaagt ggtttaaata attga                       105
//

If you have problems or comments...

PBIL Back to PBIL home page