(data stored in ACNUC7421 zone)

EMBL: CP002157.PE258

CP002157.PE258       Location/Qualifiers
FT   CDS_pept        complement(289319..289705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17421"
FT                   /product="putative tansport related protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17421"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00887"
FT                   /db_xref="GOA:A4ATW7"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW7"
FT                   /protein_id="EAR00887.1"
FT                   /translation="MKLKGRNKVSPDFSMSSMTDIVFLLLIFFMLTANSPNALDLLLPK
FT                   AKGKSTNTQNVSVSINKNLEYYVNSERINGEYIEIELKKALEGQEKPTIILRAEESVAI
FT                   KEAVNVMDIANRNNYKVILAVRPN"
     atgaaattaa aaggaagaaa taaagtaagt ccggacttca gtatgtcgtc tatgaccgat        60
     attgttttct tgttgttgat attctttatg ttaacggcaa attcgccaaa tgcgttggat       120
     ttgctattgc caaaagcaaa ggggaaatca acgaacacac aaaatgtttc agttagtatt       180
     aacaagaact tggaatatta cgtgaatagc gaaagaatta acggagagta cattgaaatt       240
     gaattaaaaa aggcactaga aggacaagag aaaccaacaa taatcctacg ggcagaagag       300
     agcgtggcca ttaaagaggc tgttaacgtt atggacattg ccaataggaa taattacaag       360
     gtaattttgg ccgtgcgacc caattaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page