(data stored in ACNUC7421 zone)

EMBL: CP002157.PE259

CP002157.PE259       Location/Qualifiers
FT   CDS_pept        complement(289716..290408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17426"
FT                   /product="putative biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17426"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00888"
FT                   /db_xref="GOA:A4ATW8"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW8"
FT                   /protein_id="EAR00888.1"
FT                   /translation="MSLIQDLAQDPEIGDVLSEEKTLSVIDLIFNGGTGSIVIISILFV
FT                   LLFVALYIYFERIFAIKAASKIDSNFMNQIRDHVTNGKLEAAKLLCAQTDSPVARLTEK
FT                   GVSRIGKPLDDINTAIENAGTLEVYKLERNVSVLATVAGAAPMIGFLGTVIGMILAFHE
FT                   MATSGGQAEMGSLASGIYTAMTTTVAGLIVGIIAYIGYNHLVNRTDKVVHKMEANAVEF
FT                   LDLLNEPL"
     atgtcattga ttcaagatct tgcacaagac cctgaaatag gggatgtttt atccgaagag        60
     aaaaccctct cggtaattga tttaattttt aacggcggta caggaagtat cgtgattatc       120
     tccattttat ttgttttatt gtttgttgca ctatatatct attttgaacg gatatttgca       180
     atcaaagccg cttcgaaaat agatagtaat ttcatgaatc aaattaggga tcatgtgacc       240
     aatggtaaat tggaggccgc taaattatta tgcgcccaaa cagattctcc tgtggctcgt       300
     ttaactgaaa aaggggtttc gagaataggg aagccattgg atgatataaa cacggctatt       360
     gaaaatgcag gtaccttaga ggtctataaa ttggaaagaa acgttagtgt tttggctacc       420
     gttgccggtg cggcaccaat gattggtttc cttggaaccg ttattggtat gattttggca       480
     tttcatgaaa tggccacaag cggtgggcaa gctgaaatgg gttcattggc atctggtatt       540
     tatactgcaa tgacaacaac agttgctggt ttaattgtgg gtattatagc ttatataggt       600
     tataaccatt tggtaaacag aactgataag gttgttcata agatggaagc caatgcagtg       660
     gaattcttgg atttattgaa cgaaccacta tag                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page