(data stored in ACNUC7421 zone)

EMBL: CP002157.PE26

CP002157.PE26        Location/Qualifiers
FT   CDS_pept        complement(40972..42255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16261"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00655"
FT                   /db_xref="InterPro:IPR021272"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT85"
FT                   /protein_id="EAR00655.1"
FT                   /translation="MREDLLHFIWKYKRLQLDDLSSTQNELIEVLEVGEHNHYAGPDFF
FT                   NAKIKIGSQLWAGNVEIHLNSSDWYAHHHEQDSNYDNVILHVVWNDDATIYRKDNSEIP
FT                   TLELLQYVPKKVLNSYQKLFDKDNHKFINCENDMAAVEGFVVNNWLERLYFERLMQKTV
FT                   VVNELLKTSKNDWESVLYTLLLKNFGLKINGESFLSLGKSLDYSVVRKFRKDPLQLEST
FT                   LFGMTGILEDVSCVDSYYLSMKKEYHYLKHKFNLDETGVLTPGFFKLRPSNFPTIRLSQ
FT                   FSNLYNKNTNLFHKIIGATTKAELYEIFEISASSYWDNHFTFGKVSKRSTKKLTKQFID
FT                   LLIINTILPIKFYHAKHLGKDSNETLLSIVNSLRGEDNSVSNRFADLGISIKTAGDSQA
FT                   ILQLYNEYCTKNKCLQCAIGSSLLNRNI"
     atgcgcgaag atttactcca tttcatttgg aagtataaaa gattacagct agatgacctg        60
     tcttcaactc aaaatgagct gatagaagtt ctcgaagttg gtgagcacaa tcattatgct       120
     ggtcctgatt tttttaatgc taaaattaag attggcagtc aactttgggc aggaaatgtt       180
     gaaatacatt taaactcatc tgattggtat gcccatcatc atgaacaaga ttccaattat       240
     gacaatgtta ttcttcatgt ggtgtggaat gatgatgcga ccatatatag aaaggacaat       300
     tcggaaatcc ctacattgga gttattgcaa tatgttccaa aaaaagtgct aaacagttat       360
     caaaaactat ttgataagga taaccacaag ttcatcaatt gtgaaaatga tatggcggct       420
     gtcgaaggtt ttgtagtaaa caattggcta gaacgccttt attttgaacg tttaatgcaa       480
     aaaacggttg tcgtaaatga actattgaaa acttccaaga atgattggga aagtgtgttg       540
     tatactttgc ttttgaagaa ttttggtctc aaaatcaacg gcgagtcgtt cttaagctta       600
     ggtaaatctt tggattattc tgttgttcgt aagtttcgta aagacccatt gcaattggaa       660
     agcactttat ttggaatgac aggtatattg gaagatgtgt cttgtgtaga ttcatattat       720
     ttatcaatga aaaaagaata tcactatcta aaacacaaat tcaacttaga tgaaactggt       780
     gttttaactc ctggtttttt taaacttcgc ccatctaatt ttccaacaat acgcttatct       840
     caattttcca atttatataa taaaaacaca aatttatttc ataagattat tggtgctaca       900
     accaaagcag aattatatga aatctttgaa atttcggcga gcagctattg ggacaatcat       960
     tttacatttg ggaaagtatc taaaagaagc actaagaaac ttaccaaaca atttatcgat      1020
     ctattgatca ttaatactat actcccaatt aaattttacc acgcaaagca tctgggaaaa      1080
     gactcaaacg aaaccttgct ttcgattgtc aacagtttaa gaggggagga taatagcgtt      1140
     tcaaatagat ttgctgattt gggtatttct attaaaaccg caggagacag tcaagccatt      1200
     ttgcagcttt ataacgagta ctgtaccaaa aataagtgct tacaatgtgc cataggtagt      1260
     agtttattaa atagaaatat ttaa                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page