(data stored in ACNUC7421 zone)

EMBL: CP002157.PE261

CP002157.PE261       Location/Qualifiers
FT   CDS_pept        complement(291813..293045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17436"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17436"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00890"
FT                   /db_xref="GOA:A4ATX0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATX0"
FT                   /protein_id="EAR00890.1"
FT                   /translation="MKELLQAYENKQPEIVFNWKDSETEAEGWTVINSLRGGAAGGGTR
FT                   MREGLDLNEVLSLAKTMEVKFTVSGPPIGGAKSGINFNPHDPRKKGVLQRWYRAVSPLL
FT                   KSYYGTGGDLNVDEIHEVIPITEDAGVWHPQEGVFNGHFKPTEADKINRIGQLRQGVIK
FT                   PIESELYTPDVSRKYTIADMITGYGVAEAVRHYYDIFGGNVMGKKAVVQGFGNVGGAAA
FT                   FYLAQMGAKIVGILDRTGGVINEEGFSFEEIKDFFLNKHNNNLMASADQMIPFEEIKER
FT                   IWTLQTEIFVPCAASRLITKNQISKMIDTGLEVISCGANVPFADKEIFFGPIMEYTDGR
FT                   VSLIPDFVSNCGMARVFAYFMEKRVGIDDDLIFKDTSDTIRKAILNIFKQNHTKLNLSK
FT                   TGFEIALKQLV"
     atgaaggaac ttcttcaagc atacgagaat aaacaacccg aaatagtctt taattggaaa        60
     gattcggaga ctgaagccga aggatggact gtgattaatt ccttaagagg aggtgctgcc       120
     ggtggaggta caagaatgag agaaggccta gatcttaatg aagtattgtc attggcaaag       180
     accatggagg tgaaattcac agtgtcaggc cctccaattg gcggtgcaaa atcaggaatt       240
     aactttaatc cacatgatcc aaggaaaaaa ggagtactgc aaagatggta tcgcgcagtt       300
     tctcctcttt taaagagtta ttatggtaca ggtggtgatt tgaatgttga tgaaatacat       360
     gaagttatcc ccattaccga ggatgctggt gtttggcacc ctcaagaggg tgtttttaat       420
     ggtcacttta agccaactga ggcggataaa attaatagaa taggccaatt gaggcagggt       480
     gttattaagc caattgaaag tgaattgtac acaccagatg tttctagaaa gtacactatt       540
     gcagatatga ttacaggata tggtgtggct gaagctgtga ggcattatta cgatattttt       600
     ggtggtaatg taatgggtaa aaaagctgta gttcaaggat ttggaaatgt tgggggtgca       660
     gccgcttttt atttggcgca aatgggagcc aaaattgtag ggattttaga tcggactggt       720
     ggtgttatca atgaagaagg gttcagtttt gaagaaatca aggacttttt tctaaataag       780
     cataataaca atttaatggc cagcgctgat cagatgattc catttgaaga aataaaggag       840
     cgaatatgga cattgcaaac cgagattttt gttccttgtg cagcatcacg acttatcact       900
     aaaaatcaga tttctaaaat gattgatact ggtttggaag ttatttcttg tggggccaac       960
     gtcccttttg cggataagga gattttcttt gggccaataa tggaatatac agatggaagg      1020
     gttagtctta ttccagattt tgtttcaaac tgtggtatgg caagagtttt tgcctatttc      1080
     atggaaaaaa gagtagggat tgatgatgat ttgatattta aagatacttc tgataccata      1140
     agaaaggcaa ttttgaatat ctttaaacaa aatcatacca aattaaattt gagtaaaact      1200
     ggatttgaaa ttgccttaaa gcaattagtg taa                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page