(data stored in ACNUC7421 zone)

EMBL: CP002157.PE265

CP002157.PE265       Location/Qualifiers
FT   CDS_pept        complement(300787..301647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17456"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17456"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00894"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATX4"
FT                   /protein_id="EAR00894.1"
FT                   /translation="MAKSKKFIGIDLGGTKVNVGLVEGDKVIETEYAKLPQNQKSESEV
FT                   IDLIVDLTKSVISRNNIDGIGIGVPSILDRKKGIIYEVQNIPLWNEVPLGNILAKEFDV
FT                   PIYMNNDANCFALGEYYFGAGQGCEHFVGLTLGTGMGSGIITNGRLLNDANCGSGEFGM
FT                   IPYKEGVLEDYCSGKFFKRHYNSNGEELLYLAKKGDVKSIEAFEQFGIHLGNAIKIILY
FT                   AIDPEKIIIGGSILNSASFFKKSLENSIQNFGYKKVLENFEIKYSNTPNIAVLGAASLC
FT                   LESKN"
     atggcaaaaa gtaaaaagtt catagggatt gatttaggtg gaacgaaggt aaatgtgggt        60
     ctagtggaag gtgacaaggt aatcgaaacg gaatatgcca agcttcctca gaatcaaaaa       120
     agtgaaagtg aagtaattga tctaattgtt gacttgacca agagtgttat ttcaagaaat       180
     aatattgatg gtattgggat aggagtgcca agtatattgg acagaaaaaa aggaatcatt       240
     tatgaggtgc aaaacatccc tttatggaat gaggtgcctt taggaaatat tttggcaaaa       300
     gaatttgatg ttccaattta tatgaataat gatgcgaatt gttttgcctt gggtgagtat       360
     tattttggtg ctggtcaagg atgtgagcat tttgtaggat taactttggg aactggaatg       420
     ggttcaggaa taattaccaa tggacgcctt ttgaatgacg caaattgtgg ttcaggtgaa       480
     tttgggatga tcccttataa agaaggtgtt ctagaagatt attgtagcgg caaattcttt       540
     aaaagacatt ataattcaaa tggggaagag ttattgtatc tggctaaaaa gggagatgtt       600
     aagtctattg aagcatttga gcaatttgga atccatttag gaaatgcaat taagattatt       660
     ttgtatgcaa ttgatcctga aaagataata attggtggct cgattttaaa ttctgcttcc       720
     tttttcaaga aaagtttaga aaacagtatt caaaactttg gttacaaaaa agttcttgag       780
     aattttgaaa ttaaatattc aaatactcca aacattgctg ttttaggtgc tgcctcactt       840
     tgtttagaaa gcaaaaactg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page