(data stored in ACNUC7421 zone)

EMBL: CP002157.PE269

CP002157.PE269       Location/Qualifiers
FT   CDS_pept        311945..312142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00015"
FT                   /product="ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00015"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99592"
FT                   /db_xref="GOA:A4AWS5"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS5"
FT                   /protein_id="EAQ99592.1"
FT                   /translation="MPKQKTKSSAKKRFKLTGTGKIKRKHAFKSHILTKKSKKRKLALT
FT                   HSGLVHDADVNSIKEQLRLK"
     atgcctaaac aaaaaacaaa atccagtgct aaaaagcgtt ttaagcttac aggtacagga        60
     aaaatcaaaa gaaagcacgc ttttaagagc cacattctta cgaagaagtc taaaaagcga       120
     aagctagcgt taacacattc tggattggta cacgatgcag atgttaacag cattaaagaa       180
     caattacgtt taaaataa                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page