(data stored in ACNUC7421 zone)

EMBL: CP002157.PE27

CP002157.PE27        Location/Qualifiers
FT   CDS_pept        complement(42315..42626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16266"
FT                   /product="rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16266"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00656"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT86"
FT                   /protein_id="EAR00656.1"
FT                   /translation="MADITQEEWRTKLKADSNAFVLDVRTKAEIEEGYIANAINIDIYL
FT                   GQGFLQELDKLDKTKNYYVYCRSGNRSRQACAVMKSIGFENTYNLEGGMMAWQGEVEQ"
     atggcagata taacacaaga agaatggaga actaagctta aggcagatag taatgctttt        60
     gttttagatg taagaacaaa ggcagaaatt gaggagggat atatcgcaaa tgctattaat       120
     atcgatatat acttaggcca aggtttttta caagagctag ataaattgga taaaaccaaa       180
     aactactacg tttattgtag atcagggaat agaagtagac aagcttgtgc cgtcatgaaa       240
     agtataggtt ttgagaacac ttataactta gagggtggaa tgatggcttg gcagggtgaa       300
     gtcgagcaat aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page