(data stored in ACNUC7421 zone)

EMBL: CP002157.PE273

CP002157.PE273       Location/Qualifiers
FT   CDS_pept        313501..314298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00035"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99596"
FT                   /db_xref="GOA:A4AWS9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS9"
FT                   /protein_id="EAQ99596.1"
FT                   /translation="MDLSHIKMVVTDMDGTLLNSQHKVSDRFFSQFQELKKRGIHFVAA
FT                   SGRQYHSIVDKLDSIKKDILVIAENGALVKDQDKELLVTPLESHLKNDLLQCIDRIDGA
FT                   HAMLCGKYNAYFDGSSTPFLEELKEYYSSFEIHDSLHAITDEIIKIAVYHNECAEEHVY
FT                   PAMKNFENQVIVKVSGQNWLDLNHSNANKGHALKQVQDRLGVLKEETIVFGDYNNDLEM
FT                   LAMSDFSFAMKNAHPNVKEVANYQTESNDNFGVELILDKLLNQ"
     atggatttat ctcatataaa aatggtagtg acggatatgg acggtacgct actgaactca        60
     caacacaaag ttagtgaccg ttttttttct caatttcaag agcttaaaaa aaggggtatc       120
     cattttgttg ccgcaagcgg aagacaatac catagtatag tcgataagct tgatagtatt       180
     aagaaggaca tactcgtaat agcagagaat ggggccttgg tcaaagatca agacaaagaa       240
     ttattggtaa ctccccttga aagtcatcta aaaaatgatc tccttcaatg tattgacaga       300
     atagatggtg ctcacgctat gctttgtggc aaatacaatg cctattttga tggaagttca       360
     accccatttc ttgaagagtt aaaagaatat tattcaagct ttgaaattca tgatagtttg       420
     catgcgataa ccgatgagat aataaaaatc gccgtttatc ataatgaatg cgctgaagaa       480
     catgtttatc ctgcaatgaa aaactttgaa aatcaagtta ttgtaaaggt atcaggtcaa       540
     aattggttgg atttgaacca ttcaaatgct aacaaggggc atgccttaaa acaggtccaa       600
     gatcgtcttg gtgttttaaa agaagaaacc atcgtttttg gtgactacaa caatgattta       660
     gaaatgttgg ctatgtctga ctttagcttt gccatgaaaa acgctcaccc caacgtgaag       720
     gaagttgcaa actaccagac tgaaagtaat gacaattttg gagttgaatt aatcttggac       780
     aaattactga atcaataa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page