(data stored in ACNUC7421 zone)

EMBL: CP002157.PE274

CP002157.PE274       Location/Qualifiers
FT   CDS_pept        complement(314303..315622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00040"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99597"
FT                   /db_xref="GOA:A4AWT0"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT0"
FT                   /protein_id="EAQ99597.1"
FT                   /translation="MITTYPFKILIRLSEPLYLRSFLITLLITIFSFQFSSASSILIPM
FT                   DAEGQKNHLKAYGITFWVLTKQQKVHWLLNYRGGSFLLPDGERIRKECQIRGVSFEILS
FT                   DNQAQSILDNISSPSQNQEAVILEKAPKIAVYTPKTNQPWDDAVTMVLTYAEIPYVTVY
FT                   DEEVLDDKLVLYDWLHLHHEDFTGQYGKFYGAYRATPWYINGKKEAEALANKLGYDKVS
FT                   EEKRDVALKIRNYVIGGGFMFAMCSATDSFDIALAADGVDICEPMFDYDPSDANYQSKL
FT                   DYNKTFAFSDFTLERNPLRYEFSSIDMTTKRGEVPKESDYFSLMDFSAKWDPVPTMLCQ
FT                   NHTSLVKGFMGQTTSFTRQEIKPTVLVLGENKINGEARYIHGIKGKGFFTFYGGHDPED
FT                   YQHRVGDPKTELELHPTSPGYRLILNNVLFPAARKKKQKT"
     atgataacga cgtacccttt taaaatatta attagattat ctgaaccctt gtacttgagg        60
     agttttctta ttacgctttt aatcaccata ttttcatttc aattttcttc agcttcctca       120
     attttaattc ctatggatgc tgaaggccaa aagaatcatc tcaaagctta tggtattact       180
     ttttgggtat tgaccaaaca gcaaaaagta cattggttat tgaattatag gggaggttct       240
     tttttacttc cagatgggga gcgtatccgt aaagaatgtc agatacgggg tgtttctttt       300
     gaaatccttt ctgataatca ggcacaaagt attttggaca atataagtag tccttcccaa       360
     aatcaggaag ctgttatttt ggaaaaggca ccaaaaattg ctgtgtatac ccctaaaaca       420
     aatcaaccat gggatgatgc tgtgacgatg gttttgacct atgcagagat accctatgta       480
     accgtttacg acgaagaggt tttggatgat aaactggttt tatatgactg gttacatcta       540
     catcatgagg attttaccgg gcaatatggt aaattctatg gtgcatacag ggccacacct       600
     tggtatatca atggtaaaaa agaagcagag gctttggcga acaaactggg ttatgataaa       660
     gtttctgaag aaaagagaga tgtagcttta aaaatcagaa attatgtaat cggaggtggt       720
     tttatgttcg cgatgtgttc cgctaccgat agctttgata ttgctcttgc tgcagatggt       780
     gtagatattt gtgagccgat gttcgattat gatccttctg atgccaatta tcaaagcaag       840
     ttagattata ataagacatt tgcctttagt gatttcacac tggaaaggaa tcctttacgt       900
     tatgaatttt catcaataga tatgacgact aaaaggggag aggttcccaa agaatcggat       960
     tatttttctt taatggattt ttctgcgaaa tgggatcctg tgcctacgat gctatgtcaa      1020
     aaccatacgt cattggtcaa gggttttatg gggcagacaa cttcatttac tagacaagag      1080
     attaaaccaa cggttctagt cttgggtgaa aacaaaataa atggggaagc acgatacatt      1140
     catggtataa agggaaaagg cttttttact ttttatggtg ggcatgatcc ggaggattac      1200
     caacataggg taggagaccc aaaaaccgag ttggaattgc accctacgtc ccccgggtat      1260
     cgtctaattt taaataacgt attatttcct gcggcaagaa aaaagaaaca aaaaacttga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page