(data stored in ACNUC7421 zone)

EMBL: CP002157.PE276

CP002157.PE276       Location/Qualifiers
FT   CDS_pept        complement(317315..318268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00050"
FT                   /product="Acetyl-CoA carboxylase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00050"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99599"
FT                   /db_xref="GOA:A4AWT2"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT2"
FT                   /protein_id="EAQ99599.1"
FT                   /translation="MEYLDFELPIKELEDQLDKCMIIGEESDVDVSETCKQIEKKLTET
FT                   RKDIYKNLTAWQRVQLSRHPNRPYTLDYINAICGDTFLELHGDRNVKDDKAMIGGLGKI
FT                   GDQSYMFIGQQKGYNTKTRQYRNFGMANPEGYRKALRLMKSAEKFGIPVICLIDTPGAY
FT                   PGIEAEERGQGEAIARNILEMTRLKVPIIVTIIGEGASGGALGIGVGDRVLMLENTWYS
FT                   VISPESCSSILWRSWEYKEQAADSLKLTAPDMKKLKLIDEIVREPAGGAHSNRDKTFEI
FT                   VKNKITAHYQELEKLSPKELVKLRMEKYANMGVFNG"
     atggaatatt tagattttga acttccgatt aaggagcttg aagaccagct agataaatgt        60
     atgatcatcg gagaagaaag cgatgttgat gttagcgaaa cttgtaagca aatcgaaaag       120
     aaattaaccg aaacaagaaa ggatatttat aaaaacttga ctgcttggca acgtgttcag       180
     ctttcaagac accccaatag gccatatacc ttggattata tcaatgctat ttgcggtgat       240
     acttttttgg agttgcatgg tgatcgtaat gtaaaagatg ataaggccat gataggtggt       300
     ctgggtaaaa taggtgatca gagctatatg ttcattggtc aacagaaagg ttataatacg       360
     aaaacaagac agtatcgaaa ttttggaatg gcaaatccag aaggatatag aaaggctcta       420
     cgtctaatga aatctgccga aaaatttggt attcctgtaa tttgtttgat tgacactccg       480
     ggagcatatc caggtatcga agcggaagaa cgtggtcaag gagaagccat agccagaaat       540
     attttggaaa tgacccgtct taaagtgcca atcatagtta ccattatcgg agaaggagca       600
     tcaggaggtg cattgggaat aggtgtaggt gaccgtgtgt tgatgttaga aaatacatgg       660
     tactcagtga tatcacctga gtcttgttcc tctatattat ggagaagttg ggaatataag       720
     gaacaggcag ctgattcctt aaaacttact gctcctgata tgaaaaagtt aaaactgatt       780
     gatgaaattg ttcgtgaacc ggctggaggt gcacatagta atcgagataa aactttcgaa       840
     atcgtaaaaa acaaaattac ggcccattat caggaattgg aaaagttatc accaaaagaa       900
     ctggttaaat tacgcatgga aaaatatgcc aatatgggcg tttttaatgg ttaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page