(data stored in ACNUC7421 zone)

EMBL: CP002157.PE278

CP002157.PE278       Location/Qualifiers
FT   CDS_pept        complement(319206..320231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00060"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99601"
FT                   /db_xref="GOA:A4AWT4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT4"
FT                   /protein_id="EAQ99601.1"
FT                   /translation="MLLLFIPIGIMANLAEQIGKMIDNDAPTNEIIIYYVNFTIYIGSL
FT                   LFPIFLFLSIIFFTSKLASNTEIVAILSSGVSYNRFLRPYLIGASIVALIMLVMAMFIV
FT                   PNASIGYNEFKFKYLKKGKQDRVTSNIFNQLNESDFIYVKSFDPARQNANQFTFERFNE
FT                   DNTLDFKISANSIRWIEKDSTYRLTKYKKRKMVGDSAIIETKNRLDTLFTFKIDDLTPV
FT                   SYIAETKNLFELNRFIENQRRKGASNINNYVLVKYRRWALPLTAFILTIIAVAVSSVKR
FT                   RGGMGINLAFGIGVAFIYIFFDKVFGTLAEQAGFSPLLAVIIPNVVFGVLAFYLLQNAK
FT                   R"
     atgcttttgt tgttcatccc aattgggata atggccaatc ttgctgagca gattggcaag        60
     atgatagaca atgatgcacc taccaatgag attattatct attacgttaa tttcacaatc       120
     tatataggaa gcttactatt tcctattttt ctgtttttat caataatatt ttttacttca       180
     aaattagcaa gtaacacaga gattgttgct attttaagtt caggagtatc ctataaccgt       240
     tttctccgac catatttgat tggtgcatcg attgtggcac tgattatgtt ggtaatggcc       300
     atgttcattg ttcccaatgc cagtataggt tataatgagt ttaaattcaa atacctgaaa       360
     aaaggtaaac aagaccgagt aacaagtaac atattcaatc agcttaatga gagcgatttt       420
     atctatgtaa agagttttga tccagcaaga caaaatgcaa accaatttac atttgaaaga       480
     ttcaatgagg ataacacctt ggattttaaa atttcggcca atagtatccg ttggatcgaa       540
     aaggatagta cttatcgctt gactaaatat aaaaagcgaa agatggttgg cgattcggca       600
     atcattgaaa caaagaatag gttagacacc ttgtttactt ttaaaataga tgatcttact       660
     cctgtttctt acatagctga aacaaaaaat cttttcgaat taaatagatt tatagagaat       720
     caaagaagaa aaggtgcatc taacatcaac aattatgttc ttgtaaaata tagaagatgg       780
     gcgctgccgt taacggcatt catcctaaca attattgctg tggcagtgtc atcggttaag       840
     cggcgtggag gtatgggaat aaacctagcg tttggtatcg gagttgcttt tatatatatc       900
     ttttttgaca aagtctttgg cactttagca gaacaggctg gtttttcacc tttattggcc       960
     gtaatcattc ctaatgttgt ttttggtgtt ttagcatttt acctattaca aaatgccaag      1020
     cgttaa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page