(data stored in ACNUC7421 zone)

EMBL: CP002157.PE280

CP002157.PE280       Location/Qualifiers
FT   CDS_pept        321685..322272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00070"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99603"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT6"
FT                   /protein_id="EAQ99603.1"
FT                   /translation="MKKTILLAVFAMVSLAATAQSGTGFGIKGGLNYNANGDYFDAAED
FT                   AIKDPSRNIGYHIGLWGKIGNRLYVRPELVYTKTKSDYDGDTFDMSKLDVPVLVGTKII
FT                   GPLHVFAGPAFQYILESEFDGISSNKIENDFTVGLNIGAGVNLGKLGVDVRYERGFSNN
FT                   EADFISGNVTELNPNRVDTRPDQLIVSLSVKF"
     atgaaaaaaa caattttatt ggcagtattt gctatggtaa gcctagctgc aaccgcacaa        60
     tccgggacag gattcggtat taaaggtgga ttgaattata atgcgaatgg cgactatttt       120
     gatgccgctg aagatgctat taaagatcca agccggaaca ttggctatca tattggtctt       180
     tggggcaaaa tagggaacag actgtatgtt cgtccagaat tggtttacac aaaaacaaag       240
     tctgattacg atggagatac tttcgacatg agtaaattgg atgtacctgt tttggtgggt       300
     actaaaataa ttgggccctt acatgttttt gccggaccag cttttcaata tatcctagaa       360
     tctgaatttg atggtataag cagcaataaa attgaaaatg attttactgt tggtttgaat       420
     attggtgctg gtgtaaatct tggcaaacta ggcgttgacg tcagatacga aagaggattc       480
     agcaataatg aagcagattt tatcagcggt aatgtcaccg aactaaaccc taatagagtt       540
     gatacgagac ctgatcagtt gattgttagt ttatctgtaa agttctaa                    588
//

If you have problems or comments...

PBIL Back to PBIL home page