(data stored in ACNUC7421 zone)

EMBL: CP002157.PE282

CP002157.PE282       Location/Qualifiers
FT   CDS_pept        323379..323753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00080"
FT                   /product="heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00080"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99605"
FT                   /db_xref="GOA:A4AWT8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT8"
FT                   /protein_id="EAQ99605.1"
FT                   /translation="MRIDKYLWHTRYFKTRNIASTACKKGQVKINGQVAKPAREIYPTD
FT                   QIVVRKNQINYQFTVLDIPKNRVGAKLVDIYRKDTTPKEAFENEELLKYSKSYYRKRGT
FT                   GRPTKKDRREIDGFLGDEEE"
     atgcggattg ataaatactt atggcatacc cgttatttta agacaaggaa tattgcttca        60
     actgcctgta aaaaagggca agtgaaaata aatggccaag ttgcaaaacc agctcgggaa       120
     atatacccta ccgaccaaat agttgttcga aagaaccaaa tcaattatca atttacggtt       180
     ttggacattc ctaaaaacag ggttggcgca aaattggtgg atatttatcg aaaagatacc       240
     actcctaagg aagcttttga gaatgaagaa ttattaaaat attcaaaatc atattatcgt       300
     aaaagaggca ccggaagacc aaccaaaaag gaccgtagag aaatagatgg gtttttgggt       360
     gatgaggaag aataa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page