(data stored in ACNUC7421 zone)

EMBL: CP002157.PE283

CP002157.PE283       Location/Qualifiers
FT   CDS_pept        323925..326366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00085"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99606"
FT                   /db_xref="GOA:A4AWT9"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT9"
FT                   /protein_id="EAQ99606.1"
FT                   /translation="MKKASFYQYSIKTQVLFNFLFIILFTLFSSFSNRNNDYYSNEKIY
FT                   IQFDKPNYYAGEDIWFKTYLLDAATHTPKTWSKVTYVELINPRNEIIETKTIKITDGGG
FT                   EGNFELSPDLISGEYTVRAYTNYMRNFDSAYFFRKKVYIKALKSDGTINKVPDANIVDK
FT                   AKPDIQFFPEGGYLVNGFLNRVGFKAVGVNGEGIAIEGTITDNASKEILELKTSKFGMG
FT                   VFEFIPKPDSSYKLNIVHEGVKLIYDLPIGIGHGTVMQVTEHDKDFRITLQSSLNNGLK
FT                   NFSLLGTQREGAVIRVKLKGAKSKSVIKVPKRILEQGIVQFTLFDNNKKPISERLSFYE
FT                   TDKASVNVSIKPSKKEYGKRELVKLEIHIDSIIQEKVQPNMSIAVTDMSAIEPDPFGLG
FT                   IKSQLLLKSELKGNIEKPGYYFNSDDPDRKRNLDILMMTQGWRKFITNDTLNDPSKPIF
FT                   FAETGISLSGQIKNFYNHNKSAIAEVSLTYDNSKELVHEVMLTDNNGQFAFNNLNFLDT
FT                   TSVIIQAKKIKNTEQRKRAKNPIMNFHIEMDSFVAPEITLKQKQRPEGFSRGPKNIATA
FT                   YLESLYQMPKGTIELDEVVLEEVITDRNSQYKKKRSLSLYKEPSHTIDFKDIKGLPYDN
FT                   WLIGLVGRIPGYSASGTLRGNISLGNSLPLYLLDGMPVEDVDDIAFLDIDFIDIVKGPR
FT                   AAIYGLRAGGGVIAIYTKDGSEKPNTAEDYKKRGIVSFEHPGYQAKKFYEPVYKTQKKE
FT                   DTKSDYRSTIYWNPTIRLDEQNKANISFYTSDVTSPYQIVLEGISLDGEIISAVTYLNL
FT                   P"
     atgaaaaaag catcttttta tcaatactcc attaaaacac aagtactttt taattttcta        60
     ttcatcatcc tgtttaccct cttctcttcc ttttcaaacc ggaacaatga ttattattca       120
     aatgaaaaaa tatacattca atttgataaa cccaattatt acgcagggga agatatctgg       180
     ttcaaaacgt atctgttgga tgccgcaaca cataccccaa aaacctggag taaagtaact       240
     tatgtagaat tgataaatcc tcgtaatgag ataatagaga caaaaaccat caaaatcaca       300
     gatggcggtg gcgaaggaaa ttttgaatta tcgcctgacc ttatcagtgg tgaatacacg       360
     gttagggcct ataccaatta tatgcggaat tttgattcag cttatttctt tagaaaaaag       420
     gtttacataa aagccctaaa atccgacgga acgataaata aagtgccgga tgcaaacata       480
     gtggataaag caaaacccga tatacagttt ttccctgagg gcggttatct ggtaaacgga       540
     tttttgaata gagtaggatt taaagcggtt ggtgtaaacg gcgaaggtat tgctattgaa       600
     ggaacaatta ctgataacgc aagtaaggaa atattggaat taaaaacctc taaattcgga       660
     atgggtgtgt ttgagtttat tcctaaacca gacagttcct ataaactgaa cattgttcac       720
     gaaggggtta aattaattta cgaccttccg attggtatag ggcatggtac agttatgcag       780
     gtaaccgaac acgacaaaga ctttagaatc actttacaat cttcactgaa taatgggttg       840
     aaaaatttta gccttttggg tacacaaaga gaaggggctg ttattagggt taaattaaaa       900
     ggtgccaaga gcaagtcggt aattaaagtg ccaaaaagaa ttctggagca agggatagtc       960
     cagttcaccc tattcgataa taacaaaaaa cccataagcg aacgcttatc gttctatgaa      1020
     accgacaaag cgagtgttaa tgtaagtatt aagccttcta aaaaagaata tggaaagcga      1080
     gaattggtga aattagaaat ccatatagac tctattatac aagaaaaagt gcaacccaat      1140
     atgtcaatcg ctgttacaga tatgtcagct attgaaccgg atccatttgg tttgggtata      1200
     aaatcacaac tcttactaaa gtctgagctt aagggtaaca tagagaaacc tggttattac      1260
     tttaattcgg atgaccctga tagaaaaaga aatcttgata tattgatgat gacccaaggg      1320
     tggaggaaat tcataactaa tgacacgtta aatgacccgt caaaaccaat ctttttcgct      1380
     gaaaccggta ttagcttaag cgggcagata aaaaactttt acaatcataa taaatcggcc      1440
     attgccgaag tttcacttac ttatgataat agcaaagaat tggtacatga agtcatgctg      1500
     acagataaca atgggcaatt tgcttttaat aacttaaatt ttttggatac aacttctgtt      1560
     atcatccaag caaaaaaaat aaaaaacacg gaacaaagaa aaagagccaa aaacccaatt      1620
     atgaattttc atatagaaat ggattcgttc gttgcgcctg aaatcacatt aaaacaaaaa      1680
     cagcgcccag aggggttttc aagagggccg aagaatatag ctacagcgta tcttgaatcc      1740
     ttatatcaaa tgccaaaagg aaccattgaa ttggatgaag tggttcttga agaagttatt      1800
     actgatagaa atagtcaata caagaaaaaa agatcattat cactatataa agaaccatcg      1860
     catactatag attttaagga cattaaaggt ttgccatatg acaattggct tataggactt      1920
     gtgggtagga taccaggata ttctgcaagc ggcacattaa gaggaaacat ttcattggga      1980
     aatagtttac cactgtatct tttagatggt atgcctgttg aggatgttga cgatatagct      2040
     tttttggata ttgattttat tgatatagta aaaggtccta gagcggcgat ttatggatta      2100
     cgtgcaggtg gtggtgtaat agccatatat acaaaggatg gttctgaaaa accaaataca      2160
     gcggaagact ataaaaaaag aggtattgtt agttttgaac atccggggta ccaagccaaa      2220
     aaattctatg agcccgttta taaaacccaa aaaaaagaag ataccaaatc tgattataga      2280
     tcaaccatat attggaaccc tacaattaga ttggacgaac agaataaggc caacatttct      2340
     ttttacacct ctgatgtaac atcaccttat cagatagtgt tggaaggaat ctcattggat      2400
     ggggaaatta ttagcgctgt aacttattta aatttaccat aa                         2442
//

If you have problems or comments...

PBIL Back to PBIL home page