(data stored in ACNUC7421 zone)

EMBL: CP002157.PE285

CP002157.PE285       Location/Qualifiers
FT   CDS_pept        complement(326947..327438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00095"
FT                   /product="putative shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00095"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99608"
FT                   /db_xref="GOA:A4AWU1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU1"
FT                   /protein_id="EAQ99608.1"
FT                   /translation="MGSGKSTIGRLLANELNYDFIDLDDFIESNEQMKIPMIFESKGEI
FT                   YFRKKEFEYLKQILANKDNFILATGGGTPCYGENMSAMLEATSNVFYLKVSISRLIDRL
FT                   VLEKEHRPLITNIPDEELPEFIGKHLFERSYFYSKANNSIFCDEKKADEIRSEIEGLLV
FT                   "
     atgggtagtg gtaaatctac gattggtaga ttgttggcca atgagctgaa ttatgatttc        60
     attgatcttg atgattttat agaatcaaac gagcaaatga aaattccaat gatttttgaa       120
     tcaaaggggg aaatctattt tagaaaaaaa gaatttgaat acttgaaaca aatactggcc       180
     aataaagata attttatact tgctacaggt ggtggtaccc cttgttatgg cgagaatatg       240
     tctgcaatgc ttgaggcaac cagtaatgtg ttttatttga aagtctcaat tagcagactt       300
     attgatagat tggttttgga aaaagaacat agaccattga taaccaatat tcctgatgag       360
     gagttgcctg agttcattgg caaacacttg tttgaacgta gttattttta ttccaaagcc       420
     aataacagca tcttttgcga tgaaaaaaag gcggatgaaa tacgttctga aatagaaggg       480
     ttattagtct ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page