(data stored in ACNUC7421 zone)

EMBL: CP002157.PE291

CP002157.PE291       Location/Qualifiers
FT   CDS_pept        335484..335900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00125"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99614"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU7"
FT                   /protein_id="EAQ99614.1"
FT                   /translation="MKKITPPFNNESAAAKVQAAEDAWNSRDAKKVSMAYTLDSQWRNR
FT                   DKFFVGRKAIVEFLKDKWLNERHYILRKYLWSYTDNRISVRFEYEWQDANSGQWKRTHG
FT                   NEHWEFDKDGLMQVRDMSANDIDIIESDRKFINH"
     atgaaaaaaa taaccccccc ttttaacaat gaatctgcgg cagcaaaagt acaagccgct        60
     gaagatgcct ggaatagtag agatgccaaa aaagtatcga tggcttacac tcttgactcg       120
     caatggagga atagagataa gttctttgta ggaagaaaag caatcgttga atttctaaaa       180
     gacaaatggt taaacgaaag gcattatata ttaagaaagt atctatggtc ctatacagat       240
     aatagaatat cggtccgttt tgaatacgaa tggcaagatg caaatagtgg acaatggaaa       300
     agaacccatg gcaatgaaca ttgggagttt gacaaagatg ggctaatgca agtacgggat       360
     atgagtgcca atgatatcga cataattgaa tcagatagaa aatttattaa tcattaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page