(data stored in ACNUC7421 zone)

EMBL: CP002157.PE293

CP002157.PE293       Location/Qualifiers
FT   CDS_pept        336509..337588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00135"
FT                   /product="hydrolase, alpha/beta hydrolase fold family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00135"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99616"
FT                   /db_xref="GOA:A4AWU9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU9"
FT                   /protein_id="EAQ99616.1"
FT                   /translation="MVGLKLIFQKHKELKTYKQFNNYNNKTKTTIMKAKTIKSVLSMAI
FT                   IFTMVLTGSSFKNTKEISKVPKSEKEAQPTYHNTVEVNGMNIFYREAGDTSKPTILLLH
FT                   GYPTSSHMFRNLLTDLSVHYHVLAPDYPGFGRSDQPLMNDFDYTFDNMSKMVEGFLSEL
FT                   KVDKYSIYLMDYGAPIGFRIAAKYPERIESLIIQNGNAYEEGLKDFWDPIKKYWNDYTP
FT                   ENGKPLEGFHSPAGLKWQYTHGVQDSTKISPDNWSIDLQHLTRKENNDIQLAMFYDYRT
FT                   NVPLYPEWQQYFREYQPPTLIVWGKNDYIFPADGAHPYKRDLKNLEFHLLDTGHFALEE
FT                   KGTEIANYILKFLEKNNIK"
     atggtgggtt tgaaattgat tttccaaaag cacaaggaat tgaaaaccta caaacagttt        60
     aataattata acaacaaaac aaaaacaaca atcatgaaag caaaaacaat caaatcagtt       120
     ttaagtatgg ccattatttt taccatggtc ctaacaggtt cttcctttaa aaatacaaag       180
     gaaataagca aagtgccaaa atcagaaaag gaagcacaac ccacctatca caatacggta       240
     gaggtcaatg gaatgaatat tttttataga gaagcaggtg atactagtaa gcccacaatc       300
     cttttattac acggctaccc tacttcttcg catatgtttc gaaatttatt gacagacttg       360
     tctgttcatt atcatgtttt agctccggat tatcctgggt ttggacgtag tgatcaacct       420
     ttaatgaatg attttgacta tacgtttgac aatatgtcaa aaatggtaga aggtttccta       480
     tcagaactaa aagttgataa atacagcatt tacttaatgg attatggcgc accaataggc       540
     tttagaattg ctgccaaata cccagaaaga atagaatcat tgattatcca gaacgggaat       600
     gcctatgagg aaggcttaaa agatttctgg gatccaatca aaaagtattg gaatgattac       660
     accccggaaa atggaaaacc cctggaagga tttcattctc ccgcaggcct aaaatggcaa       720
     tacacccatg gtgtacaaga ttcgacaaaa attagtcctg ataactggag cattgacctt       780
     caacacttaa cacgtaaaga gaacaatgat atacaattgg caatgttcta cgattacaga       840
     accaatgttc ccttatatcc tgagtggcaa caatacttta gggagtacca acctcctacc       900
     ctgatcgtat gggggaagaa tgactatata ttccctgctg atggggccca cccatacaaa       960
     agagatttaa aaaatttgga attccattta ctggacacag gtcattttgc tctcgaagaa      1020
     aaaggaactg aaatagcgaa ttacatttta aaatttctag agaaaaacaa catcaaataa      1080
//

If you have problems or comments...

PBIL Back to PBIL home page