(data stored in ACNUC7421 zone)

EMBL: CP002157.PE297

CP002157.PE297       Location/Qualifiers
FT   CDS_pept        338625..339920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00155"
FT                   /product="penicillin-binding protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00155"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99620"
FT                   /db_xref="GOA:A4AWV3"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV3"
FT                   /protein_id="EAQ99620.1"
FT                   /translation="MKTTKRILKYLAITLFAIALWIVTVVSSTMNGWWRESITNESDIK
FT                   SFIHAVNDEVKNQFVGNFAMATINNGKVEAEIFHTAGTVVDRNTVFQVASLSKWVSAVG
FT                   VMKLVENGKLDLDVPVSTYLTRWQLPESKYNNDKVTVRRLLSHTAGLTDGLGYSGFESE
FT                   ESIQELEASLTNAADADKGVSGVVEVGVEPGEFKYSGGGFTLLQLLVEEVSGESFTSYM
FT                   KNTIFEPLNMNYSNYKWNEDSGYKLVEFYNDDGSEAKHYRYTSLAATSLYTSISDLELF
FT                   FQFFMKGKNNEPIGRNVLKPETLKSMREVHATSLGMDIWGLGTILYTKTDNGDFIIGHD
FT                   GKSTPPINTAVRLNPETGDGIIVLETGNSDLATKLASEWVFWKTKKVDVILFAMSEDKM
FT                   KSIIGRGVISIVILSILMGVIRYRKKYAKRTK"
     atgaaaacca ctaaacgcat acttaaatat ttggcaataa cattatttgc gattgcccta        60
     tggattgtta ctgttgtatc gagtacaatg aacggatggt ggcgcgaatc aataacaaat       120
     gaaagcgata tcaaatcatt tattcatgct gtcaatgatg aagtcaaaaa tcagtttgtt       180
     ggtaattttg ccatggcgac aattaacaat ggtaaagttg aagctgaaat atttcacaca       240
     gcaggaaccg tagtagatag aaatacggta tttcaggttg cctctttaag taagtgggta       300
     tcggctgttg gagtcatgaa attggtagaa aacggcaagc tggatttaga cgttcccgta       360
     agtacatact taactagatg gcaattaccg gaaagcaagt acaataatga caaagtaacg       420
     gttagaaggc ttttaagtca tactgccggg cttactgatg ggcttggtta ttctggcttt       480
     gaatcagaag aaagcataca agaacttgag gcttcattaa caaatgccgc ggatgcagat       540
     aaaggtgttt caggggtggt cgaagttggt gttgagcctg gtgaatttaa atactccgga       600
     ggaggcttta cacttttaca actacttgtt gaagaagtta gtggggaatc gtttacctca       660
     tatatgaaaa acaccatttt tgagcctttg aatatgaatt attcaaacta taaatggaat       720
     gaggattctg gctataaatt ggtagaattc tataatgatg atgggtctga ggctaaacat       780
     tatcgatata cttctctggc cgctacatca ctttatactt caatatcaga tttggagttg       840
     ttctttcaat ttttcatgaa aggaaaaaac aacgaaccaa ttggcagaaa tgttctaaaa       900
     ccagagacat taaaaagtat gagagaagta catgcaactt cactgggtat ggatatttgg       960
     gggcttggaa ctattctata taccaaaaca gataatggag attttattat tggtcatgac      1020
     gggaaaagta cacctccaat taatacagca gtacgactga atcctgagac tggagatgga      1080
     attatagtat tagaaacagg taattcagat ttggccacaa aattggcaag cgaatgggtg      1140
     ttctggaaaa cgaagaaagt agatgttatt ttattcgcaa tgtctgagga taaaatgaag      1200
     tccataattg gaagaggtgt tatatcaatt gtaatcttat caatactaat gggcgtgata      1260
     cgctacagaa aaaaatatgc aaagcgcaca aaataa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page