(data stored in ACNUC7421 zone)

EMBL: CP002157.PE299

CP002157.PE299       Location/Qualifiers
FT   CDS_pept        340369..340971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00165"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99622"
FT                   /db_xref="GOA:A4AWV5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV5"
FT                   /protein_id="EAQ99622.1"
FT                   /translation="MNYTSDIVFTPAVKKFQEQFKSRNSYARMEQFGGWNSKVSSDLEG
FT                   FLKDMDSFYFGSANADGQPYIQHRGGKKGFLKVVDNETLAFADFSGNKQYISIGNLSEN
FT                   NKATIFLMHYVSQTRIKIWGTAYVDTDESLIASLRDENYNAKIERAIVFKVKAWDVNCK
FT                   QHIKQRFAADEIKKITEPLESKIKTLETTIDHLKSNN"
     atgaattata ccagcgacat agtattcacg ccagccgtaa aaaagtttca agaacaattt        60
     aaatccagaa acagttatgc tcgaatggaa cagtttggtg gttggaattc taaggtttca       120
     tcagacttag aaggctttct aaaagacatg gattcatttt actttggatc tgcaaatgca       180
     gatggacaac cttatattca acatcgcggt ggcaaaaagg gctttttaaa agtcgttgac       240
     aatgaaactt tggcctttgc tgatttttca ggtaacaaac aatatatctc aattggtaat       300
     cttagcgaaa acaataaagc caccattttt ttaatgcatt atgtatcaca aaccagaata       360
     aaaatttggg gaactgctta tgtagatact gatgaatcat taattgcttc gctgcgggac       420
     gaaaactata acgcaaaaat tgaacgtgct atagttttta aagtaaaagc ttgggatgtt       480
     aattgcaagc agcatataaa acaacgtttc gctgctgatg aaataaagaa aatcaccgag       540
     cctttggagt ccaaaattaa aaccttggaa acaacaattg atcatttaaa atccaataat       600
     tag                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page