(data stored in ACNUC7421 zone)

EMBL: CP002157.PE303

CP002157.PE303       Location/Qualifiers
FT   CDS_pept        343875..344591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00185"
FT                   /product="possible pirin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00185"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99626"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV9"
FT                   /protein_id="EAQ99626.1"
FT                   /translation="MKSIIHKANTRGIANHGWLQSHHSFSFGNYHEPNRMNFGMLRVLN
FT                   DDVVSARMGFSTHPHKNMEIISIPLKGDLEHKDSMGNVAVIKEGDVQVMSAGKGISHSE
FT                   HNRSSENEVRFLQIWVIPNKNNVEPRYDQITLKNRDVGNQLVQILSPNENDDGVWIHQD
FT                   AWFHLGDFEKGKERFYELKDKTNGVYAFVLEGDITIENQTLNKRDGFGIWDIDKITIKA
FT                   DSNSKLLLMEIPMTNK"
     atgaaaagta ttatacataa agcaaatacc agaggaatag ccaatcacgg atggttacaa        60
     tctcatcatt cattcagttt tggtaactat cacgagccca acagaatgaa ttttggaatg       120
     ttgcgcgttt taaatgatga tgtggtaagc gccagaatgg gctttagtac gcatccgcat       180
     aaaaacatgg agataatttc tattccgtta aaaggtgatt tagagcacaa ggatagcatg       240
     ggcaacgtgg ccgtaatcaa agaaggtgat gtacaggtca tgagtgctgg aaaaggcata       300
     tcacacagtg aacataacag gagttcagag aatgaggtga ggttcctgca aatttgggta       360
     attccaaata aaaataatgt tgaacctaga tatgaccaaa tcactttaaa aaatcgcgat       420
     gtcggcaatc aacttgttca aattctttct cctaatgaaa atgacgacgg ggtttggatt       480
     catcaagatg cctggtttca tttgggggat tttgaaaaag gaaaagagcg attttatgag       540
     ttaaaggaca aaactaatgg agtttatgcc tttgtattag aaggagatat aaccattgaa       600
     aatcaaactt taaataaaag agatggtttc ggtatttggg atattgataa aataaccatt       660
     aaggcagatt ctaactccaa acttttgtta atggaaattc caatgacaaa taaataa          717
//

If you have problems or comments...

PBIL Back to PBIL home page