(data stored in ACNUC7421 zone)

EMBL: CP002157.PE305

CP002157.PE305       Location/Qualifiers
FT   CDS_pept        345442..346512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00195"
FT                   /product="NADH-dependent flavin oxidoreductase, Oye family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00195"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99628"
FT                   /db_xref="GOA:A4AWW1"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWW1"
FT                   /protein_id="EAQ99628.1"
FT                   /translation="MNLFKFFPLGNTTLKNRIVMAPMTRSRAIGNIPNELMAEYYQQRA
FT                   SAGLIISEGTSPSPNGLGYPRIPGAYSDDQILGWKKVADAVHAKDGKIFIQLMHTGRIT
FT                   AKANLPVGSIALAPSSIQAPGEMFTDTDGMVAHDTPKAMTLEEIETVKNEFVNSAKRLI
FT                   NEADIDGIELHAANGYLLNQFINPNSNQRVDSYGGSIVNRTRLVLEVAEAVVAEIGSDK
FT                   VGIRFSPYGAFNDMLSDYEDLEDTFVYLSKELKKMNIAYINVVDQRVAFGAPDFITDIK
FT                   KTIKHHFKRTVISGGDIDSIEKAEGILDSGLDLVYVGRPFISNPNFVEKLQNGTELTAP
FT                   DMNTFYSPGENGYTDY"
     atgaatttat ttaaattttt tcctttagga aacacaacgt taaaaaacag aatagtaatg        60
     gctccgatga cccgtagcag ggctattggc aacattccga atgaattaat ggctgaatac       120
     tatcaacaaa gggcaagtgc tggtctaatt atatcagaag gtacgtctcc atcccccaat       180
     ggccttggat atcctcgtat tccaggagca tattccgatg accagattct tggctggaag       240
     aaagttgccg atgctgtaca tgcaaaagat ggtaaaattt ttatccaact aatgcatact       300
     ggcagaatta cggcaaaagc taatttgccg gtgggaagta tagcacttgc cccttcgagt       360
     attcaagctc ctggagaaat gtttacagac actgacggaa tggttgctca tgatacacct       420
     aaagcaatga ctttggaaga aattgaaact gttaaaaatg aatttgtaaa ctctgcaaaa       480
     aggttgataa acgaagctga tatagatggt atagagttgc atgctgccaa tggctattta       540
     cttaaccaat ttatcaaccc aaattccaat caaagagtag actcttatgg tggttctatt       600
     gtaaatagaa cacgccttgt acttgaagtg gctgaagctg ttgttgcaga aataggatca       660
     gataaagttg gcattcgctt ttcaccatat ggcgccttta atgatatgct atcagattat       720
     gaagatttag aagatacttt tgtttatcta tcaaaggagt tgaaaaaaat gaacattgcc       780
     tatattaatg tagtggacca aagagttgct tttggtgcac ctgattttat aacagatatt       840
     aagaaaacca ttaaacacca tttcaaaaga actgtaatat ctggcggaga tattgatagc       900
     attgaaaaag ctgagggtat tcttgatagt ggtttagatc tagtgtatgt gggaagacca       960
     tttatctcta accccaattt tgtggaaaaa ctacaaaatg gaaccgaatt gacagcaccg      1020
     gatatgaata cattctattc accaggagaa aatggttata ctgattattg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page