(data stored in ACNUC7421 zone)

EMBL: CP002157.PE306

CP002157.PE306       Location/Qualifiers
FT   CDS_pept        346659..348410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00200"
FT                   /product="FmtA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00200"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99629"
FT                   /db_xref="GOA:A4AWW2"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWW2"
FT                   /protein_id="EAQ99629.1"
FT                   /translation="MAQKTVLIEEYLNRALVDEKLTGAVWSIVDEEVITTGALGSRNAN
FT                   TKEILKETDKVLVGSITKTLIATGILRLSSQGKLDLDSPVQKIVPHIPFDNPWKENHPV
FT                   TIRDLLNHTSGIEDSRFWQVFSTKPSANEPLEHVFTKNFSVLKVRTKPGSRFSYSNMGY
FT                   TFLGLIIEKTTGEPYETYLDQNLLLPLGMNNSTFKFTTQIGNTLDQTMAMGHFDNGATQ
FT                   ENIPMFLRPAGQFTTTASDMALFAKFLMNDGHINEKPFIDIELLQHMGQPKTTESYKNG
FT                   LTSGYQFGLSYRDRYGVVGKFHRGNTFGYRATFYLFPEQKKGFFISFNSDSETADYEKF
FT                   NTIFINHLGITKPDKLKPKDGLPSNIKEFEGYYRMNPVRFKMFAYLDLLFNSIQVQTIN
FT                   NELFIKSIQNEPYSLLPVGGHLFRKEDRVNPSHVLYKNEGVQFIGDGLVTYEKSSSVYL
FT                   GLLWLSFIVGIIGLLIILIRGSYLLFQNKLFKKIQIIPLPFLSILGLVIPIPFLLNQSF
FT                   LNLGEFTIANVLLAIVTGILPMALILSSLKIKKANALKVDIIGVLFALQWIVVLIYWNL
FT                   VPLRLWI"
     atggcacaaa agactgttct tatagaagag taccttaata gagcactagt tgatgaaaaa        60
     ttaactggtg ctgtttggtc aattgtcgat gaagaggtca ttaccaccgg ggcattaggt       120
     tcaagaaatg ccaacacaaa agaaatttta aaagaaactg acaaagttct cgttggttca       180
     ataacaaaaa cgctaatagc aacaggtatt ctccggttat caagtcaagg taaattagat       240
     ttagatagtc ctgttcaaaa aattgtacca catatccctt ttgataatcc ttggaaagaa       300
     aatcacccag ttactattcg agatttatta aatcatactt ctggcattga ggattcaaga       360
     ttctggcaag tgtttagtac aaagccttcc gccaatgaac ctctagagca tgtttttact       420
     aaaaattttt ctgtattgaa agtaagaacc aaaccagggt ctaggttttc ttattcaaat       480
     atgggctata cttttttggg cttgattatt gaaaaaacta cgggagaacc ctatgaaact       540
     tatttggatc aaaatctact tcttccatta ggcatgaata atagtacatt taaatttacg       600
     actcaaatag gtaatacttt agaccaaact atggccatgg ggcattttga taatggggca       660
     acacaagaaa acatccccat gtttttgcgc cctgcagggc agtttacaac aacggcaagt       720
     gatatggctt tatttgcaaa gtttttaatg aatgatggtc atataaatga aaaacctttc       780
     attgatatag aattactaca acacatgggc caacccaaaa caactgaatc ctataagaat       840
     ggattgactt caggatatca atttggtcta agttatagag atagatatgg cgtagttgga       900
     aaatttcatc gaggaaatac ctttgggtat agggcaacgt tctatttatt tcctgagcaa       960
     aaaaaaggat tctttatcag ttttaattct gatagtgaaa ctgctgatta tgagaagttc      1020
     aataccattt ttataaatca ccttggaatc actaagccag acaagcttaa accaaaagac      1080
     ggtttacctt ctaatattaa agaatttgaa ggttattatc gcatgaaccc tgttcgattt      1140
     aaaatgtttg cttatctgga tttacttttc aattcaatac aggtacaaac aataaataat      1200
     gagttattta ttaaatccat tcaaaatgaa ccttactctc ttttaccagt tggtggtcat      1260
     ttattccgaa aagaagatcg agtaaaccct tcccatgttc tatataagaa tgaaggtgtc      1320
     caatttattg gtgatggttt ggtaacttat gaaaaatcaa gttcagttta tttgggccta      1380
     ttgtggttga gctttattgt tggaataata ggtttactaa ttattctaat tcgaggttct      1440
     tacctacttt ttcaaaataa acttttcaaa aaaatacaga ttataccatt gccattttta      1500
     tccattttag ggcttgtaat tccaattccg tttcttctaa atcaatcttt cttaaattta      1560
     ggcgaattta cgattgcaaa tgttctattg gctatagtta ccggaattct tcccatggca      1620
     ttgattctta gtagtctaaa aataaagaag gccaatgcat taaaagtaga tataataggg      1680
     gttttgtttg ctttacaatg gattgtagta ttaatctatt ggaacctagt tcctttaaga      1740
     ttatggatat ag                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page