(data stored in ACNUC7421 zone)

EMBL: CP002157.PE318

CP002157.PE318       Location/Qualifiers
FT   CDS_pept        356362..357099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00275"
FT                   /product="Protein containing acetyltransferase (GNAT
FT                   family) domain"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00275"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00055"
FT                   /db_xref="GOA:A4AV33"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV33"
FT                   /protein_id="EAR00055.1"
FT                   /translation="MNEANTLISLNIDNLTSLWKTVSMPYHSYFSESRFDYCFMKDFDW
FT                   PNRLWFHKDLSQEIISSTKEKIISISATLTIPYWDIYGHKILKSLESEGYVNQFEQVGM
FT                   SLKLDKPLKVEDNLNIQLVTKKSDAILWSQLFKSSFGYKIHPEILIKSLKKIDYYIAYS
FT                   QEHVVGTAIAYNTNKVMGVHSVGIPPAMRRKGYAEQIMKLLINSAVKNGSQYMTLQASD
FT                   MGKHLYLKLGFQEDFVIKNYKLS"
     atgaacgagg ctaatacgtt gataagtctg aatatagaca acctcacttc tctttggaag        60
     acagtaagta tgccttatca ttcctatttt tctgaatcgc gctttgatta ttgctttatg       120
     aaggactttg attggcctaa cagactttgg tttcataaag atttaagtca agagattatt       180
     tcttcaacca aagaaaaaat aatttcgatt tccgccacac taacaattcc ttattgggat       240
     atttacggtc acaaaatttt aaaaagctta gaatctgagg ggtatgtaaa tcagtttgaa       300
     caagtaggaa tgtctttaaa attggacaaa ccgcttaaag ttgaagacaa tctaaatatt       360
     caacttgtta ctaaaaagtc tgatgctatt ctgtggtcac aattattcaa aagttcattc       420
     ggatacaaaa tacatccgga aatactcatt aaatcgttga agaaaattga ctactatata       480
     gcatattctc aggagcatgt ggtgggtacg gctattgctt acaatacaaa taaagtaatg       540
     ggcgtccatt ctgtaggtat ccccccagct atgagaagaa aaggatacgc agagcaaata       600
     atgaagttac taataaactc ggcggttaaa aacggaagtc aatatatgac cctacaagct       660
     tcggatatgg gaaagcacct atatttaaag ctaggatttc aagaagattt cgtaattaaa       720
     aattacaaac ttagctag                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page