(data stored in ACNUC7421 zone)

EMBL: CP002157.PE319

CP002157.PE319       Location/Qualifiers
FT   CDS_pept        357143..357676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00280"
FT                   /product="ribosomal-protein-serine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00280"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00056"
FT                   /db_xref="GOA:A4AV34"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV34"
FT                   /protein_id="EAR00056.1"
FT                   /translation="MNTDFRNYKIIEFDTKQCGPLYDLIDSNRERLETYFAGTVKNTKT
FT                   LEDTISYCKQIDMRVKNKSYYIYTITNKENNSLIGLIDVKNIDWNVPKAEIGYFIDFNH
FT                   QGKGIITNAVAILIEYLLKEYNFKKLLCRINSENIGSIKVALNNGFKLEGTIRNDYRTT
FT                   SNEIVDLNYYGRIF"
     atgaatacgg attttagaaa ttataaaata atcgaatttg acacaaaaca gtgcggcccc        60
     ctttatgact taatcgattc taatcgggag cgccttgaaa catattttgc tggtacggtc       120
     aaaaacacaa aaacattaga agacacgatt agttactgta agcaaatcga tatgcgggta       180
     aagaataaga gctattatat atataccatc actaataaag agaacaactc gctcattgga       240
     ttaatagatg ttaagaatat tgattggaat gttccaaagg cagaaattgg ttattttata       300
     gattttaacc atcagggaaa gggaattatt actaatgctg ttgcaatttt aattgaatac       360
     ttattaaaag aatacaattt taaaaaattg ctttgtcgta taaatagtga aaatattgga       420
     agcatcaagg ttgctttaaa taatggattt aaacttgaag gtactattag aaatgattat       480
     agaacaacca gcaacgaaat agtagattta aattattatg gtaggatatt ttga             534
//

If you have problems or comments...

PBIL Back to PBIL home page