(data stored in ACNUC7421 zone)

EMBL: CP002157.PE326

CP002157.PE326       Location/Qualifiers
FT   CDS_pept        361518..362627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00315"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00063"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV41"
FT                   /protein_id="EAR00063.1"
FT                   /translation="MKRFIPRIFAILIIILLTQSQAFSQSTKLALNEELWLATETTKVS
FT                   FETFDGREAVMLEGDLGLKNSNYIEGVMTMDVYCTSKRSFAGMFFHKSDGNKDEIYLRQ
FT                   HKSNQVDAIQYTPVFNNEGNWQLYHKFQAKANFKLNEWNNLKVEFNKTQANVYVNDELL
FT                   LTINDLQGVSESGEIGLWSLFPSWISNVSFEETKVDIENDLAIEPKLNSNYITKWQLSE
FT                   SYSFESLNAILDESKNLAFKNVTADNSGLLPISKYVTKKSAGNFERNAEDIVVAQFKVS
FT                   SEIKEIKKMYFDYSDRCIVLLNGNELFSGNNSFRLKGPQFMGHLNPDANALNLNLMKGE
FT                   NTVQIILIEKANGWGLSAKFEDLERIQLH"
     atgaaacgtt ttattccaag gatttttgca atacttatca ttattctttt aacgcaatct        60
     caggcatttt cgcaatcgac taaattagcc cttaacgagg agttatggct agcaacggaa       120
     actactaaag tttcttttga aacctttgat ggacgagaag ccgttatgct ggaaggggat       180
     ctaggcctaa agaattccaa ttacattgaa ggtgtcatga caatggatgt ttattgtacc       240
     tcaaagcgtt cattcgcagg aatgttcttt cataaatctg acggaaacaa agatgagatc       300
     tacctaaggc agcataaatc caatcaagta gatgctatac aatatacacc cgttttcaat       360
     aatgaaggta actggcaact ttatcacaaa tttcaagcta aagctaactt caaacttaat       420
     gagtggaaca atctcaaagt cgagtttaat aaaacccaag ctaatgttta tgtaaacgat       480
     gaattactgc ttacaataaa tgatcttcaa ggagtatcag aaagtggcga aataggcctc       540
     tggtctttgt tcccaagctg gatatccaat gtttcatttg aagaaaccaa ggttgacatc       600
     gaaaatgatt tggcaattga acccaagttg aattcaaatt acattactaa atggcaactt       660
     tctgagagct attcttttga atcactgaat gccattcttg atgagtctaa aaatctagct       720
     tttaaaaatg taacagcaga taattccgga cttcttccaa tctcaaaata tgtgaccaaa       780
     aaaagtgccg gaaactttga acgaaacgct gaggatattg tagttgctca atttaaagtg       840
     tcctcagaga taaaagagat taagaaaatg tattttgatt atagtgatcg ttgtattgta       900
     ttgctaaatg gcaatgaact gtttagcggc aataattctt ttagactcaa aggaccacaa       960
     ttcatggggc atttgaaccc cgatgccaac gcgttaaacc taaatttaat gaaaggtgaa      1020
     aatactgttc aaataattct tattgaaaaa gccaatggct ggggattatc cgcaaagttt      1080
     gaagatttag aacgtatcca attacattag                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page