(data stored in ACNUC7421 zone)

EMBL: CP002157.PE329

CP002157.PE329       Location/Qualifiers
FT   CDS_pept        365049..365246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00330"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00066"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV44"
FT                   /protein_id="EAR00066.1"
FT                   /translation="MANPVTQNDDAWLEKLRLLLAAMALHLLQTSFNPKEIKLDRLRDN
FT                   LHAILTIADLKKATDKLNQK"
     ttggcaaatc cagtaacaca aaatgatgat gcatggttag aaaaactacg cctcctatta        60
     gcagctatgg cacttcattt attacaaacg tcttttaatc caaaagaaat caagctagat       120
     cgattacgcg ataatttaca tgctatttta acaatagcag atcttaaaaa ggcaaccgat       180
     aaattgaatc aaaaatga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page