(data stored in ACNUC7421 zone)

EMBL: CP002157.PE330

CP002157.PE330       Location/Qualifiers
FT   CDS_pept        365266..366768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00335"
FT                   /product="penicillin-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00335"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00067"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV45"
FT                   /protein_id="EAR00067.1"
FT                   /translation="MKINLAYIILVILFTLEASTLSGQESFKHTELKTKINTYLNNSVS
FT                   NGYSGSVLVAKNGEIILSKGYGWSDRIRKINNTSSTVFNIGSVTKQFTAAAILKLIEQE
FT                   KIKTSDNIGQFFKKAPLDKKEITIHQLLTHTSGISPKTGGYRYDEASKEHFINTFFEAS
FT                   LQSKPGTKHKYANANYIMLSAIIELVSEQDYTTFLNDNFWKPLKMFHTGYKSISFNSEQ
FT                   LAHGYYFNYSDGIWKDWGTTQEHLPYTDNHWYSIGKGDIHSTVEDLYKWHVALNIGQIL
FT                   NAKSKVLFETPYVAEDVAGTSHYGYGWAIFRSKQNTKTVTHNGSNGIYFANFIRYIDDD
FT                   VVVIELSNAILGKETESVAWRISDIVFDENYIPKPISKSVYELVYDFMKTNEVENVKLI
FT                   SSFLEKNIGQKFNDRAVFNRIGNKLLEKENNPGWGLELLKLNVEIFSNDGNLFDSLGDA
FT                   YFKYNQRENTIQAFTRALELKPIDNCHWCKNSNNKLNLLKNH"
     atgaaaataa atctcgctta cattatcctt gtaattctat ttactttaga agcaagcact        60
     ttatctggac aggaatcatt taaacatact gagcttaaaa ctaaaatcaa cacttattta       120
     aacaatagtg taagcaatgg atattcagga tccgtactag tggccaaaaa tggagagatt       180
     atattatcaa aaggttatgg ttggtcagat aggataagaa aaatcaacaa cacatcctca       240
     acagttttca atataggttc agtaacaaaa caatttactg ccgctgctat tctaaagtta       300
     attgagcaag aaaaaattaa aacttcggac aacattggtc agttctttaa aaaagcacca       360
     ttagataaaa aagagataac cattcatcaa ttacttacac atacatcagg aatatctcca       420
     aaaaccggtg gttatagata tgatgaagcc agtaaagaac atttcattaa tacttttttt       480
     gaagcttcac tgcaatcaaa accaggtaca aaacataaat atgccaatgc aaactatatt       540
     atgctttcgg ccattattga attggtctcc gaacaagatt acacgacttt cctaaacgac       600
     aatttttgga aaccactcaa aatgtttcat actggctata aaagtatttc ttttaatagt       660
     gagcaacttg ctcatggata ttatttcaat tattctgatg gcatttggaa agattgggga       720
     acaactcaag aacatttacc ttatactgat aatcattggt atagcatagg caaaggggac       780
     attcattcca ccgttgagga cctttacaaa tggcatgtag cactaaatat cggtcaaata       840
     ctaaatgcaa aatccaaagt attgtttgaa accccatatg ttgcagaaga cgtagctgga       900
     acttctcatt acggatacgg atgggcaatt ttcaggagta aacaaaacac taaaactgta       960
     acccataatg gtagcaacgg catttatttt gcaaacttca ttaggtatat tgatgacgat      1020
     gttgttgtta ttgaattatc aaatgcaatt ctaggaaagg aaactgaaag tgttgcttgg      1080
     cgaatcagtg atatagtttt tgatgagaac tatattccaa aaccaatttc aaaatcagta      1140
     tatgaacttg tttacgactt tatgaaaacc aatgaagtag aaaacgtaaa actgatatct      1200
     agttttctag aaaagaacat agggcaaaaa tttaatgata gagcggtatt caatagaata      1260
     ggaaataaac tactggaaaa agaaaacaat ccaggctggg gattagaact actcaaacta      1320
     aatgtagaaa tattctcaaa tgacggtaat ctttttgatt cacttggaga tgcatatttc      1380
     aagtacaacc aaagagaaaa tacaattcag gcttttacta gagctttgga attaaaacca      1440
     atagataatt gtcattggtg taaaaactcc aataataagc ttaatttact taaaaaccat      1500
     taa                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page