(data stored in ACNUC7421 zone)

EMBL: CP002157.PE345

CP002157.PE345       Location/Qualifiers
FT   CDS_pept        379138..379590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00410"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00082"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV60"
FT                   /protein_id="EAR00082.1"
FT                   /translation="MALNFNQYATEGNTFIKNYTKEMNLGEDKDKAGRILSAILHALRD
FT                   IIPTEESLQLIAQFPMFLKAVYVNGWTIKRDRPRIKQMAEFIDLVRKHDGPSAINDFEY
FT                   SDDVAEQYIDTTFILLRKYISLGELEDIRDGLPKDLKSMIYSNIMF"
     atggcactta attttaatca atacgcaacg gaaggaaata catttataaa aaattatacc        60
     aaggaaatga atcttggtga agacaaagac aaagcgggta gaattctatc agccattctt       120
     catgcacttc gcgatattat acctacagaa gaatcattac agcttatcgc tcaattccca       180
     atgttcttaa aggccgtcta cgtaaatggc tggaccataa aaagagatag gccaagaata       240
     aaacaaatgg cagagttcat tgatttggta agaaaacatg acggaccatc tgcaataaac       300
     gactttgaat atagcgatga tgttgcggag cagtacatag acacaacctt tattctatta       360
     agaaaatata tttccttggg agaactggaa gatattagag atggtttacc caaagattta       420
     aaaagcatga tttactctaa tatcatgttt taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page