(data stored in ACNUC7421 zone)

EMBL: CP002157.PE351

CP002157.PE351       Location/Qualifiers
FT   CDS_pept        complement(383576..384595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00440"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00088"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV66"
FT                   /protein_id="EAR00088.1"
FT                   /translation="MNYKYIFTSLTRISDLAEKEFQLKELPKKQWETGDYVVCKIVNAG
FT                   SETLKLELPNGRMRGIIGGETIVGALGDRFATLEATGTWRNVEDDLKMTVLTGAGLLGK
FT                   MTSKSVFIPQMMQVIYLGHAFRGAKKLTMESFVKPILTLPYKTPVVLFVGTSMSAGKTT
FT                   SARIVTNLFKQAGHKVVGAKLSGAGRYKDILAIKDVGADAIYDFVDVGLPSSICPQEKF
FT                   QKKLNQLLSRIELHKADIAIVEIGASPLEPYNGDVAIERLREHIKCIVLSASDPYAVYG
FT                   LMKAFDIVPNIVTGVASNTLGGKRLVEQLCKVKSLNLIDSTTTKELKRIITATTGFSL"
     atgaactata aatacatatt tacatccttg acacgaattt ctgatttggc agaaaaagaa        60
     tttcaattga aagaactacc aaagaaacaa tgggaaactg gggattatgt ggtatgtaaa       120
     atagtgaatg caggaagtga aactttgaag ttggagttgc caaatggaag aatgcgtggg       180
     ataatcgggg gagagactat tgttggagcc ctaggtgacc gttttgcaac tttggaagcc       240
     accgggacct ggagaaacgt tgaagatgac cttaaaatga ccgtattgac aggagctgga       300
     ttattgggta aaatgacatc aaagtcagtt tttatacctc aaatgatgca agtgatttat       360
     ttaggacatg cctttagggg ggcaaaaaaa ctgaccatgg aaagttttgt taagccaata       420
     ctcactcttc catacaaaac acctgtggtg ctgtttgttg gcacgtcaat gtcagcaggt       480
     aaaaccactt cggctagaat tgttacaaat ttattcaaac aggcaggtca taaggtagtt       540
     ggggccaaac ttagcggggc aggaaggtac aaggacattc tggcgataaa ggatgttggt       600
     gctgacgcta tttatgattt tgttgatgta ggattgcctt catctatttg tccacaggag       660
     aaattccaga aaaaattaaa tcaattattg agtagaattg aactgcataa agcggatatt       720
     gctattgttg aaataggtgc ctcacctttg gaaccgtata acggggatgt agccattgaa       780
     aggcttcgag agcatattaa atgtatagtt cttagtgcct ctgaccccta tgctgtttac       840
     ggattgatga aagcttttga tattgtccca aatattgtaa ccggtgttgc aagtaatact       900
     ttgggaggca aaagattggt tgagcaactt tgcaaggtta aaagcttgaa tttaattgat       960
     tcaacaacaa ctaaagaatt gaaacgaatc ataacggcta ccactggttt cagtttataa      1020
//

If you have problems or comments...

PBIL Back to PBIL home page