(data stored in ACNUC7421 zone)

EMBL: CP002157.PE353

CP002157.PE353       Location/Qualifiers
FT   CDS_pept        complement(385777..386388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00450"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00090"
FT                   /db_xref="GOA:A4AV68"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV68"
FT                   /protein_id="EAR00090.1"
FT                   /translation="MDVLQKDNIISLDVRLPIWEHFFTVAPLVVIGTKEKEGYDLAPKH
FT                   MATPLGFGNYFGFVCTPRHGTYQNVKTNKEFSVSFPRPDQIVTTSLTSSPRSEQISKSH
FT                   AIIEVLPIVKATTMDVPMIKDAYLFFECELFKIIDGFDDYCIISGTIKAAHVHKNYLRV
FT                   FEKDEQEQLHENPLLAYIASGRFAKISDTYSFPFPKDFKR"
     atggatgttc ttcaaaaaga taatataatc tcgttggatg ttaggttgcc tatctgggaa        60
     cactttttta ctgtcgctcc tttagttgtc attggcacta aggaaaaaga ggggtatgat       120
     cttgcgccaa aacacatggc cacaccttta gggtttggca attattttgg tttcgtttgt       180
     acacctaggc atggtacata tcaaaatgtg aagacaaaca aggaattttc ggtcagtttt       240
     ccgagaccag atcagatagt aaccacctct ttaacctcat ccccccgttc tgaacagatt       300
     tctaaatcgc atgcaattat tgaggtattg ccaattgtca aggcaaccac aatggatgtg       360
     ccaatgatta aagatgctta tttgttcttt gaatgtgaac tattcaaaat aatcgacggt       420
     tttgatgatt attgtatcat ttctggcacg ataaaagcag cacatgtgca taagaattat       480
     cttagggtat tcgaaaaaga cgaacaggaa cagctgcatg aaaatccatt gctggcttat       540
     atagcttcag gtcgttttgc aaaaatttct gatacctaca gttttccatt tcctaaggac       600
     tttaaaagat ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page