(data stored in ACNUC7421 zone)

EMBL: CP002157.PE354

CP002157.PE354       Location/Qualifiers
FT   CDS_pept        complement(386515..386904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00455"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00091"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV69"
FT                   /protein_id="EAR00091.1"
FT                   /translation="MDYYFNKTLTNLSFDEVVDKTTLALKEEGFGILTEIDIKTTLKNK
FT                   LDINFPNYKILGACNPPFAHKALLAENKIGTMLPCNVIVRETENGSIEVAAVDPIVSMM
FT                   GIKNKDLGEIANEVRNKLKKAVDNL"
     atggattatt atttcaacaa aacacttact aatttgtctt tcgacgaagt agttgacaaa        60
     acaacgctag ccttaaagga agagggtttt ggtatactca ccgaaataga tattaaaacg       120
     acattgaaaa ataaattgga tatcaacttc cctaattata aaatcctggg tgcttgtaat       180
     ccaccctttg cacataaagc cttactggcc gaaaacaaaa ttggaacgat gttgccctgt       240
     aatgtaattg tccgcgaaac tgaaaatggc agtattgaag ttgctgccgt agaccctatt       300
     gtatctatga tgggtataaa gaataaagac cttggtgaaa tagctaatga ggttagaaat       360
     aagttaaaaa aagcagttga taatttgtag                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page