(data stored in ACNUC7421 zone)

EMBL: CP002157.PE355

CP002157.PE355       Location/Qualifiers
FT   CDS_pept        complement(387507..388487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00460"
FT                   /product="virulence factor Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00460"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00092"
FT                   /db_xref="GOA:A4AV70"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV70"
FT                   /protein_id="EAR00092.1"
FT                   /translation="MAKTSLENLKLGVFVVFGTILLVTVAYLIGNRQNMFGQTFTISAV
FT                   FNNANGLQNGNNVRFSGINVGTVKAIDMVNDTTIRVSMIIEKKMLNHIRKDAIATIGSD
FT                   GLVGSMILNIIPGEGSSPLIVEGDKLQSYSRIATQDMLSTLNTTNENAAILTANLLKVT
FT                   QAMTKGRGTMGRLLNDTLMAGDLKATLENLKNASHEANNMIKKLNLTISKINNEDSVFA
FT                   VLLNDSLNGVKMKNILSNMEKSSIDINELTKNLNVVVDDMTNGKGAMNYLVMDTVLVKS
FT                   LKNTIRNIEEGSGRFNENMEALKHNFLTRRYFKKIEKRKEKSQVD"
     atggctaaaa catctttaga aaacttgaaa ttgggagtat ttgtagtatt cggaaccatt        60
     ctgttggtaa ccgttgctta tttgattggt aacagacaga acatgtttgg acaaaccttt       120
     acaatcagtg cagtgttcaa taatgcaaac ggactccaaa acggaaataa tgttcgtttc       180
     tctggtatta atgtgggaac cgtaaaagct atagatatgg ttaatgacac tactataaga       240
     gtttcaatga taattgaaaa aaagatgttg aaccatattc gaaaagacgc catagcaact       300
     attggatcgg acggtctggt ggggagtatg attcttaata taatcccggg tgaggggtcg       360
     tcacctttaa tagttgaggg tgataagctg caatcctaca gtagaattgc gactcaggac       420
     atgttgagta ctttgaatac caccaatgaa aatgcagcaa ttttgactgc caatttgtta       480
     aaagtgacac aagccatgac gaagggacgg ggaaccatgg gtagattatt gaatgatact       540
     ttaatggcag gtgacttaaa agcaactctt gaaaatttaa aaaatgccag tcatgaagct       600
     aacaatatga ttaagaaact aaacctaacg ataagtaaaa tcaacaatga agatagtgtc       660
     tttgcagtat tgttaaacga ttcgctaaac ggggtgaaaa tgaaaaacat actttccaat       720
     atggaaaaat ccagtatcga tattaatgaa ctaaccaaaa acttgaatgt tgttgtagat       780
     gatatgacaa atggtaaggg agctatgaat tatttggtta tggacactgt cttggtaaaa       840
     agcttaaaga atactattag gaatatagaa gagggttcag gtcgctttaa tgaaaatatg       900
     gaggcattga agcataattt tcttaccaga agatatttta aaaaaataga gaaaagaaaa       960
     gagaaaagtc aagtagatta a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page