(data stored in ACNUC7421 zone)

EMBL: CP002157.PE366

CP002157.PE366       Location/Qualifiers
FT   CDS_pept        complement(398114..399007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00515"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00103"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV81"
FT                   /protein_id="EAR00103.1"
FT                   /translation="MFFRLKKSLFNKFSWVFMAFFFVACNSVWKDNSGEGPIARVGESY
FT                   LYKEDVVPFLTEGMTKEDSTSLVTGYINNWASKQLLLSKSKINLSEDKLAEFDALVNTY
FT                   RTDLYTRAYKEALVQQGSDTVVSQSQMEGFYKKEKENFKLKEKIISLRFIELPLQFLNK
FT                   ETVISKLKKFDDDDVTYLDSIGVQFKKLNFNDSIWVSASRVREEIPPLTLENQNRYLKK
FT                   SQFFELQDSLGVYLAKITGVLEINDIAPLSYIEPSIKQVLLNRRKLDYIRRLETEIIDE
FT                   AIKEKEFEVYVQDKKD"
     atgtttttta ggttaaaaaa gtcactattc aataaatttt catgggtgtt catggcattt        60
     ttctttgtgg catgcaattc cgtctggaaa gataattcag gtgaaggccc aatcgccaga       120
     gtaggggaaa gctatttgta taaagaagat gttgttcctt ttttaaccga gggcatgacc       180
     aaagaagaca gtacctcttt ggttactggt tatattaata attgggcctc aaaacagtta       240
     ttactttcta agtccaaaat caatctatct gaagataagc ttgccgaatt tgatgctttg       300
     gttaatactt acagaactga cttgtacact agagcctata aagaagcgct tgttcaacag       360
     ggcagtgaca ctgttgttag ccaatctcaa atggaagggt tttataaaaa agaaaaagag       420
     aactttaagt taaaagaaaa gataataagc ctacggttta tagaattacc attgcaattt       480
     ctgaataagg aaactgtcat aagtaaactc aaaaaatttg atgatgatga tgttacctat       540
     ttggattcta ttggcgtaca atttaaaaag ctcaatttta acgattcaat atgggtgagt       600
     gcttcgcggg ttcgagagga aatcccaccg ttgacccttg aaaatcagaa tagatactta       660
     aaaaaatcac aattttttga attgcaggat tcattagggg tatatttggc aaagattacc       720
     ggggtactcg aaatcaacga tattgctccg ttgtcatata ttgaaccctc tattaagcag       780
     gtactactaa accgcagaaa gttggactat attcgaaggt tggaaaccga gattatagat       840
     gaagctatta aagaaaaaga attcgaagtc tatgtacaag acaaaaaaga ttaa             894
//

If you have problems or comments...

PBIL Back to PBIL home page