(data stored in ACNUC7421 zone)

EMBL: CP002157.PE371

CP002157.PE371       Location/Qualifiers
FT   CDS_pept        401928..403325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00540"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00108"
FT                   /db_xref="GOA:A4AV86"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV86"
FT                   /protein_id="EAR00108.1"
FT                   /translation="MSLIIINLDKINIKDSILKLSIMTNKLFQGTNKMYSAIILAILFI
FT                   GMAGIPNASAFFQDEQEQEINFKQYKGEIRDADNKKPLVFATLTVEGTNISTISNTEGE
FT                   FALKVPKDMSEGNVLISFLGYKTKLLPLAQFKDGNNKIYMDISIVELSEVSLSIPTNAE
FT                   GLVRETLKKRGQNYFDDPTLMTAFYRETIKKRKRNVSLSEAVVNIYKTPYTSSRKDAVQ
FT                   LYKARKSTDYSKLDTIALKLQGGPFNALFVDIMKYPEYIFADNSLNKYDFSFDRSTKVK
FT                   DRQIFVVNFIQKPSVHEQLYKGKLYIDAENKILTSAIYALNITNKHEASKLFVRRKPRN
FT                   AKVWPNEVAYRVDYREKNGRWYYGYSNVLLEFKIDWDKKLFNSVYSMTCEMAVTDWEKN
FT                   LSNEMPKSKERIKTSIILGDEAIGFADPDFWGEYNIIEPEKSIESAIKKIQRQLKKSKT
FT                   RGGTSAP"
     atgtcgctaa ttatcattaa cttagataaa atcaatatta aagattcaat attaaaatta        60
     tcaatcatga cgaataaact ctttcaagga accaataaga tgtattctgc aattattctt       120
     gcgatactat ttattggaat ggccggtatt cccaatgcat cggctttttt tcaagatgaa       180
     caggaacaag aaataaactt taaacagtat aagggtgaaa taagagatgc agacaataaa       240
     aaacccttgg tgttcgctac cttaacggtt gaagggacca atatcagtac tatttccaat       300
     acagagggag aattcgccct gaaagttcca aaagatatga gtgaagggaa cgtcttgata       360
     tcttttttag gatataaaac caagttgtta ccattggcac agtttaaaga tggtaacaat       420
     aaaatttata tggacatctc aattgttgaa ttgtctgaag taagtctgag tatccctacc       480
     aatgcggagg gcctggtgag agaaacttta aagaaaagag ggcaaaatta ttttgatgac       540
     ccaacattaa tgaccgcctt ttacagagag accattaaaa aaaggaaaag gaatgtctca       600
     ctttccgaag cagtagtaaa tatatataag accccttaca catcgagcag aaaagatgcc       660
     gtacagttat ataaagctcg aaaaagtacg gattacagca aattggatac aattgccctt       720
     aaacttcaag gaggtccttt taatgcccta tttgtagaca taatgaagta tcctgaatat       780
     attttcgcag ataattcatt gaacaagtat gattttagtt ttgaccgttc tactaaagta       840
     aaggacaggc aaatttttgt tgttaatttt attcaaaaac catctgttca cgagcaatta       900
     tataaaggta aattatatat agatgctgaa aacaagatat tgaccagtgc catttacgct       960
     ttgaacatta caaataaaca tgaagcttct aagctattcg tgagaagaaa accaagaaat      1020
     gccaaagtat ggccaaacga ggttgcttat agggttgatt atcgagagaa aaacggaaga      1080
     tggtattacg gctatagcaa tgtactcttg gagtttaaaa ttgattggga taaaaagtta      1140
     tttaattctg tatatagcat gacctgtgaa atggctgtaa ccgattggga aaagaatcta      1200
     tctaacgaaa tgccaaaatc caaagagcga ataaaaactt ctattatttt aggtgatgaa      1260
     gccataggtt ttgcggatcc tgatttttgg ggtgaatata atattattga acctgaaaaa      1320
     tctatagaat cagcgattaa gaaaattcaa cgacaactta aaaaatctaa aactcgtgga      1380
     ggcacttctg ctccttaa                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page