(data stored in ACNUC7421 zone)

EMBL: CP002157.PE377

CP002157.PE377       Location/Qualifiers
FT   CDS_pept        409301..410491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00570"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00114"
FT                   /db_xref="GOA:A4AV92"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV92"
FT                   /protein_id="EAR00114.1"
FT                   /translation="MWLKKLFFFFTFLFSLAIYSQIPELSPLSKISVLTCGSGDQLYST
FT                   FGHSAFRVQDKAVGIDVVYNYGVFDFRSKNFYGKFAKGKLDYTLARQQYSNFIREYKYD
FT                   QRWVNEQQLELTQLERNELFKFLENNYLPENRAYQYDFFYNNCSTKIWDVLKNVFGNRL
FT                   SIDENYLQKQFTHRELIHQNMPTNSWSAFGIDLALGAVIDDMATPKEHMFLPSYIMQQL
FT                   NTSLLDSEAIAPQQIAIYKPTPIENTNNFFLTPLFWSLVLMTIVFVVTYFDFKKAKRSG
FT                   WLDFSLLLFTGVAGVIIFFLWFLTDHTATASNYNILWAFPLNLNLAFFVWRVKPFSKLI
FT                   EWYILILLFFLVVTAIIWLLGIQIFSPVIIPILLALVARYTFLYFSNRNQNSQKSK"
     atgtggttaa aaaagttatt tttcttcttt acgtttttgt tttcacttgc gatttactca        60
     caaatacctg agctgtcgcc attgtcaaaa ataagtgtgc ttacctgtgg gtcaggcgat       120
     cagttatatt ctacgtttgg ccatagtgca tttcgggttc aagacaaggc ggtcggaatt       180
     gatgtagtat ataattatgg agtttttgac tttagatcaa aaaactttta tgggaagttt       240
     gcgaagggaa agttagatta caccttggcc agacaacagt attcaaattt cattcgtgaa       300
     tataaatatg atcaacgctg ggtgaatgaa cagcaacttg aactaacgca attggaacga       360
     aatgagttgt ttaaattttt agagaacaac tatctcccag aaaacagggc ctatcaatat       420
     gattttttct ataataactg ttcaaccaaa atttgggatg ttttaaagaa tgtattcgga       480
     aatagattat caatagacga aaattacctg caaaaacagt ttacccatcg agagctcata       540
     caccagaaca tgccaacaaa ttcatggtct gcttttggta ttgatttggc cttaggggca       600
     gtaatcgatg atatggcaac accaaaggaa catatgttct tgccttcata cataatgcag       660
     caattgaata cttctttatt ggactctgaa gccatagcac ctcagcaaat agctatttat       720
     aaacctacgc caatagagaa tacaaacaac ttttttctaa caccgctttt ttggtcattg       780
     gttttaatga caatcgtttt tgttgtcact tacttcgatt tcaagaaagc aaaaagaagc       840
     gggtggctgg actttagtct attattattc actggagttg caggagtaat tatctttttt       900
     ctttggttct taaccgatca tacggcaact gcaagcaact ataatatatt atgggccttc       960
     cctctaaatt taaatcttgc cttttttgtt tggcgagtta aacctttttc aaagttgatt      1020
     gagtggtata ttctaatcct cctcttcttt ttagtggtga cagcaataat atggttacta      1080
     ggaatccaaa tattttcacc tgtaattatt ccaattctac tggcacttgt agctaggtat      1140
     acatttttat atttcagcaa tagaaatcaa aattcccaaa aatctaaatg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page